SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30008111m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30008111m
Domain Number 1 Region: 45-196
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-26
Family Nuclear receptor ligand-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30008111m
Sequence length 241
Sequence
MPREERLKILHELKKEASCATWEEKRKIELRQFTDSIHQSFREIFKQYRGSRQLKEKSNG
FLGYGILPMREMYDRDEICEVLRHWATTVVEKVARFAKEALPDFRALQLGDQVTLLKYAA
FEIYLIMASSRYTADGLWFPEHGVFIKRETLDALQIQNLFESKFKFYDKINRMYLTEREV
ALFCALSLASPGRFALHLNEYLHLAKELCFCFLVKSPNYRPMFLFGVSRIFISQTDLENI
M
Download sequence
Identical sequences Sakowv30008111m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]