SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30013069m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30013069m
Domain Number 1 Region: 11-119
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000104
Family Nuclear receptor ligand-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30013069m
Sequence length 144
Sequence
MAGQIPYLANHDEAWKWFKEIILDMEGLQPLVLQCKSQIVSAVEAFRRFYATPGELALFS
AVVILNQDVPQLTNRKAVEKLNNIAQRALKQEVLEFRENLQLYEDMSVFLPHLVNMNAAL
KSGFRTGQPCINFELPALCAELYY
Download sequence
Identical sequences Sakowv30013069m Sakowv30013070m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]