SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30014378m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30014378m
Domain Number 1 Region: 338-518
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-43
Family Nuclear receptor ligand-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 43-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-27
Family Nuclear receptor 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30014378m
Sequence length 535
Sequence
MDTTHYTRVAKEKEMNEIREQHSRAMFVSSMAPQNKYTSDYSQLRCLVCSDKASGLHYGV
VSCESCKSFFGRKIKSKAKFTCEEGGNCVMDLYTRRHCPACRLQKCLTVGMKPERVWDDK
RLETRKPLVRKARKKKEASPVPVVMNPESTCSSIEDDLYMELTEDQLDIIDTIHQGLENS
RKAHKEILTSERLQQVAKGISDFFKMAAKNGPPPLMNLEEMDKNMFCKSEQPENSCLVPD
SMKTKLPPLPDVWKTFSSTMPDFQFPNPQSQGPNLSNVEIKQEKLDTDEYPCQFGENSQS
QVQGAAALPNFGGGMPPMLPCFDKSELIVFNMAVLGVVIRQTVQFAKTLPEFRYLDYEDQ
AVLIKAAILEVLMFRMGETFLPEKNCVVDDIVGIEWNLDIMLYSGFFNSAQKTLNFTRSI
NSFHLSRAEFSLLEAATILSSDRPELKHPNAVELIQQKILLTLQASCKTNHPDDKVLFAK
LVVKLAEVRELVQNHIDDLNEFKLPNHESMFPLISEIFNMDEEMYSGMSQNADTS
Download sequence
Identical sequences Sakowv30014378m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]