SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30014894m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30014894m
Domain Number 1 Region: 215-334
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.18e-32
Family Dystroglycan, domain 2 0.0000716
Further Details:      
 
Domain Number 2 Region: 99-192
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-17
Family Dystroglycan, N-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 552-651
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000151
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30014894m
Sequence length 943
Sequence
MADDSTQHTNSIRNNLFSYAEWINARSLLSQRTMPCKHHRISVPHSYKGALLLVLVVSLL
LPTANAESLTNLGAKVVRVVPGGALDSGVTWRDVSMLWGVADTKATVGKVFKYAIPSDAF
NGDVINYQVNEAGSSDIPSWMYFNDASNTIEGIPTHEDVHQYYISVTAYGHSHNNTYTSK
AVDVFSIDVVNGPSIESSSAATPLNEYSKNGKVKCTDGEPEALATIILDANWSKMTPKHR
VHSVERMAEYSGFDKNLFKLLPAGKDGLFNSNALVAGPGNIKHQNYPGILLSWPVGCGYD
VNKLPVVMVIESTAKDGGLAKNIGHDVIGWHISHPQQKISKRMKRQIAAMATIVPTLLPT
QISPTSTTDVRGMESTAIPSGRVVPSETSPVMSEVIRTKISPTKSIMPTVKPTDTKVRTP
SASPTKKMTSKTKTPGLMTAMPTPTPAPPLPTKAVTEGPSRTYSAPSVTETEGLSTVPVM
TVKPSPSMSKTAVPSRVYVTPTDESTQVIITPTPTPPHVTKKPVVPIKPLYPSKEPPRTA
LPGPTQKPNQKPQLMNHIDRVYAYEGEMLVYRVPEDTFYDEEDGSTRNLKLMLLSIDGGI
LHKMSWIQFDSSSQTIYGLPMAEQAGKHEYVMTAIDSFGDIARDAFEVVVVASVNKPNHE
FSITLSNDYEEFENDVHKKLDLIDRIAKLYGDDSADTISISYFKKGSTIFGWSNNTLPQE
PCPETKIGELTKLIRDTSNGIEGEPSQALKDALAPEYEVVNIGFKPLGSCTDGYSEGTTA
DPSGPDAAESAKSTSEDDIWLITIVPAVIFAVVVLIGGLIAFCLYRRCRKGKLSDEDKHT
FISKGIPIIFANELDENDKPPSSKTPLIMKDEKPPLPPEYPGKSSPTTQPLLSHAPSSKG
DDIDEEEDPPYEPPPPFSSSPDSRQSTPRYTPAYRSPPPYVPP
Download sequence
Identical sequences Sakowv30014894m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]