SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30016230m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30016230m
Domain Number 1 Region: 2271-2362
Classification Level Classification E-value
Superfamily Immunoglobulin 7.52e-23
Family I set domains 0.0093
Further Details:      
 
Domain Number 2 Region: 2169-2266
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 1046-1103
Classification Level Classification E-value
Superfamily BPTI-like 5.82e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 4 Region: 1310-1367
Classification Level Classification E-value
Superfamily BPTI-like 1.42e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 5 Region: 1444-1512
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-18
Family Thyroglobulin type-1 domain 0.00071
Further Details:      
 
Domain Number 6 Region: 1161-1242
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.49e-18
Family Thyroglobulin type-1 domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1662-1735
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.2e-17
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 8 Region: 1108-1165
Classification Level Classification E-value
Superfamily BPTI-like 1.26e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0013
Further Details:      
 
Domain Number 9 Region: 2087-2176
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-17
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 10 Region: 1514-1586
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.23e-17
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 11 Region: 856-910
Classification Level Classification E-value
Superfamily BPTI-like 7.09e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 12 Region: 1246-1316
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.11e-17
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 13 Region: 977-1035
Classification Level Classification E-value
Superfamily BPTI-like 9.22e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 14 Region: 1365-1438
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000123
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 15 Region: 1587-1660
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000759
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 16 Region: 919-977
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000965
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 17 Region: 485-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 18 Region: 84-136
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 19 Region: 365-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 20 Region: 597-660
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 21 Region: 663-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 22 Region: 544-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 23 Region: 425-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30016230m
Sequence length 2401
Sequence
MRFNFIARYTIRVTVQGVKQTQQTRSLLAPQCHCCIQKFGQTTGPNMEMRYRRALQLLLV
VCVIHIATAEETEVQRVARQAGSDYWGEWGEFGLCSRTCGGGVSFQERKCHSIRTDGGHS
CVGANRNYRSCNIQDCPEGSRDFRAEQCSEYDEVPFEGKYYKWVPYTGAPNKCELNCMPK
GEHFYYRHSLQVVDGTRCNADSPDVCVDGSCQNVGCDFMLGSNAREDKCRECGGDGSSCK
TVEGVFDLQGIPVGYNDMILIPAGATNILIEELTASDDFLAIRNGSEHYYLNGDWRISPP
TVINAAGTLLYYERKTNAYPAPEVIRALGPTTEPIFIVLLSQGINSGVKYEYSIPHGVNS
PDPDIYSWVFDNFGECSQKCGAGYQLRGVTCARNHDYKTVADYLCDAELKPTHNKTCNTQ
PCPAMWFVGEWSPCSHSCGRHGTQVRLVYCEQILQGTVPAVVDEAFCRSREGPKPVYARH
CNEDIECPQWQVGRWSRCSAQCGDGIQRRDVTCTSNSVVPDDHCDELEKPDVKKDCNLGP
CEGVEWMVSHFSECSQDCGRGLKTRQVYCASQTGIIFPDELCNEKRMPKIVEECFSTSAC
PPDWHASTWSECSSECGEGIQTRTVVCASMVDSDLEVQSADECDATTKPASTQTCESEPC
EAMWFSGPWTRCTEPCGTGGRSRQVMCFSSGSIVVDALCDFVSRPHDRERCNEQPCDEDN
SPVFIGNPVEALELDCEDSEFGCCLNGITAADGPFQYGCPPVSYRDCVDTVHGCCEDGET
PASGPDFEGCGQEILTGCQATEYGCCDDGVSFALAADKAGCPESNVIVNCVSALYGCCPD
GLQAAKGPNNEGCDEEDACSSPLDRGDCRAFVTKWYFEEAYGRCTRFWYGGCDGNANRFD
TEDGCISECLQSDADPPQEVLCTLPYEVGPCKGQFPSWYFDPDADDGHGECKQFMFGGCK
GNKNRFRDKSTCDHACGTLTRDPCSLPVEPGSCKGSHLRWYYNQQTQICEDFTYTGCFGN
PNRFLDKSTCERKCNVVTDQDILRERRPPRCTLEKDGGPCRAQLPKYYFNSASGQCESFI
YGGCRGNENRFDSEKRCEETCVSIEKASPQAVCSLPRKEGRCRAYILQWHYDEELNFCTE
FYYGGCDGNANRFNSQEECQALCTGGDGVGGQETLCEQRRSQSLQGSRGQLGRYVAQCKQ
DGRFEPLQCHQSTGFCWCVDDNGEERQATRSPPGTQKPNCEGHKEETLCNRKYQSALEDV
QALAGRYIPQCTAEGEFQPMQCDPSSGFCWCVDGDGNDIPDTKLAPPDRPTCTNLCTLPK
DPGPCYAAISKWHYNSGTQQCEEFIYGGCKGNANRFNTFENCVETCRITEENVGQSNCRR
QRQQALGIPGALVPECTDSGKFTPIQCQGADCWCVNENGDEIIGTRRGPEDARPDCQDEQ
PDDTPCRRQYIEAIADSEFIVGLFIPQCTQSGEFESTQCHGSTGYCWCVTDNGEEIPNTR
RSPNEDQVICQEVPRGDTECHRQRSHALSNLLPGQIVPQCAEETGGFLPRQCWANSGYCW
CVNELGKEVPGTRTGPHDPRPECDKYQPKRDTLCRSLRADALVRLYPDQFIYECTQDGDF
EPLQCYGFTGSCWCVNQKGEEVTATRSTRYEPAPDCEAYRPLGTPCLRHREEARNSIDLG
GRAYIPACRDDGFYSEIQCYSGQDAGYCWCVDYKGQEISGTRTLERGKTPNCKGTTEPEY
TIDSGEVEGSGSDEDDVISVIIPGIIDDCRYAPHGCCPDHITPANGPNFFGCPTIIAEDI
EVEIAPVVGDCRSSPYGCCSDGRTPASGPGGIGCPVVEKEPDTDSCRTTFYGCCPDRVRA
ALGPGYLGCPGVIPEEVDREVIPIVGDDCLSTPYGCCPDRITVANGPGGIGCPKIVEEEI
DREGVPVTGGDCRTTPYGCCADDKTPANGPGFIGCPPVVEDEIDREVIPDIGSDCRSTFF
GCCPDGVTVAGFNNDGCPSVINEEIDREEEPVVGENCNSTPYGCCSDGITPASGFDFYGC
VEDEIDVEDSQGYGCVTTRYGCCLDGINAALGANLFGCPGARPASVIPGPSDITVDEGDS
ITLQCSASGLPKPQVEWMKGSYKINDLNIDNLIDIGNGSFTIRDIAAEDAGIYACSAYNG
LGQPAIYRVFVTVLVPVEIQEGQSVVTASRGETVQLKCHATGVPKPNVYWHKGSVRLPAG
IPRFSQIQDDSLEISSVSLSDAGDYVCTGVNNVGTIQKKTITLVVHADVDIISGPLDITA
TVGDIITLTCQATGSPPPSIKWSVNGVPVAKVGRFIVQGNGDLYITSVHKSDSGVYTCTA
ANGRNTVSASSEVTVTGAPVDPNCKDDSEFANCKLILAGNFCSNKYYARFCCKTCSDNGF
V
Download sequence
Identical sequences Sakowv30016230m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]