SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30016840m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30016840m
Domain Number 1 Region: 112-125,190-409
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-53
Family Nuclear receptor ligand-binding domain 0.0000604
Further Details:      
 
Domain Number 2 Region: 42-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30016840m
Sequence length 410
Sequence
MAASRSEQEQSVLSNSPAFSSQSTTHAQNEDSLSPSVTTTTELLCLVCSDKGSGYHYSVF
SCEGCKGFFKRTVQKQLKYSCKESRNCEITKYSRNSCQSCRFQKCVNMGMKIDAVREDRT
PGGKQKIKRSRSHSSSLPVNQSTKKTFPNVSDTNNDTASSSSLTDTNSPQPEKRLKEDSD
VSQEDQSKAYETMAELLTAARPDIVPEAQSFKDMSNFGIDDLMQYGYKELQLIIQWARHV
PGFRGLLIEDQMALLKASFMELNVLRLAYRSRSENGLVRFGANMKLTKDQAMEIGWGQEL
IQSTLNYVSRIQEVNVDHVEFCFLNAIVLTYPDAAGLQDKTSVTTLQAKIVDALRHYIKT
HYPKDAKRYAKVLLRLPTLRTVASKATERFLSMTLDGTIQINELVSEMMG
Download sequence
Identical sequences XP_002737359.1.86028 Sakowv30016840m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]