SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30021096m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30021096m
Domain Number 1 Region: 227-467
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000141
Family Tyrosyl-DNA phosphodiesterase TDP1 0.006
Further Details:      
 
Domain Number 2 Region: 140-249
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000628
Family Tyrosyl-DNA phosphodiesterase TDP1 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30021096m
Sequence length 615
Sequence
ATRVWIEPEDGKMGHFFFNKLQFQDGSYWDYQNIGATQILTFSDLVPVDGLQSVFITHDA
WFSDPSFVTGYFPSSVIVSIVCPKRHHQKGVCNYQLLDCISHRKEVIGYETESGELVDVK
CECPNKSVIEIIQPDFSHKMNAKLMIMRYQTYARIVVSSVSLDQTSWRTVGHYGWYCDLP
MDSQQRNMHPAPSGSFGDTLARFLEEITVKPASVLRGISFSELSPTVKLVMSVPARNCQC
DIFRHGMHSIGHQISGLSWPSAEPNLIYQTPVVDFENRAYSFIALLGKLSSLNQASLSGT
ERKDYESQLKLNEMKIVYPSNVQETSAFVFQNGFEKMSYCDSKFYTRQYMFHNEDPVFGK
VAWNSRIMSRFCEVSDVNPKTQAARKFGWLFVGSFDLSCNSWGEVSVKDRGVCIWSYQSY
ELGVLHIPQKVNTPEGPQLWSPDFSTIVLPYNETTLVKYPQYAYPIMQRPDSHHPQLVGR
LFFKGSTVFIQDTFPRNKQEEDFIGDPQLNKNNWNAARASCYHDTPARLRQTTINKCPGF
VPEIGSLIVFHVSPPSMNPFQSGRRSKSQQGLNVLWICDYMYPESCLCPMVPMGLMLLLK
FRSKQTSPLWLDTLE
Download sequence
Identical sequences Sakowv30021096m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]