SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30021549m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30021549m
Domain Number 1 Region: 17-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-64
Family BAR domain 0.0008
Further Details:      
 
Domain Number 2 Region: 269-346
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000028
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30021549m
Sequence length 347
Sequence
MEGFKKFSAEAGTLFTRAKQYTEEKLGSAEKTEYDAHFENLMQRAERTRRWTELIVQQTE
TVLQPNPNARIEDYVMEKVDRKRSDRVTNPEILGQTMVDAGNDIGPGTAYGAALVKCGQV
QQKLGVAEKELISTSIHNYLQPLKNFLDGDMKTINKERKLLENKRLDLDAAKSKLRKTKS
DESKAKVTPGDIEKSEEELRVAQSEFDKQYEITKLLLEGVSNAHANHLRCLQDFVEVQHA
YFVQCTGLIADLQKQLTSLPGAGNHSNSVNISSAPSAPPKFHDRAPTGTRRARVLYDYDA
ADLSELSLLADEIITVYSLPGMDSDWMMGERGNQKGKVPVTFLELLD
Download sequence
Identical sequences XP_006818767.1.86028 Sakowv30021549m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]