SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30021550m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30021550m
Domain Number 1 Region: 17-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.61e-64
Family BAR domain 0.00066
Further Details:      
 
Domain Number 2 Region: 261-338
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000267
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30021550m
Sequence length 339
Sequence
MEGFKKFSAEAGTLFTRAKQYTEEKLGSAEKTEYDAHFENLMQRAERTRRWTELIVQQTE
TVLQPNPNARIEDYVMEKVDRKRSDRVTNPEILGQTMVDAGNDIGPGTAYGAALVKCGQV
QQKLGVAEKELISTSIHNYLQPLKNFLDGDMKTINKERKLLENKRLDLDAAKSKLRKTKS
DESKAKSEEELRVAQSEFDKQYEITKLLLEGVSNAHANHLRCLQDFVEVQHAYFVQCTGL
IADLQKQLTSLPGAGNHSNSVNISSAPSAPPKFHDRAPTGTRRARVLYDYDAADLSELSL
LADEIITVYSLPGMDSDWMMGERGNQKGKVPVTFLELLD
Download sequence
Identical sequences Sakowv30021550m XP_006818769.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]