SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30024121m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30024121m
Domain Number 1 Region: 194-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000172
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 323-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000469
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 235-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  Sakowv30024121m
Domain Number - Region: 297-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 6-61
Classification Level Classification E-value
Superfamily PR-1-like 0.000327
Family PR-1-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30024121m
Sequence length 550
Sequence
MYCSVHSFYCKLYRMVTWYSMFSVGCAQQYCSKLQDTFKETVVENVVYWKCNFENVGEYR
NNAIRPYSVSSDGVCSQCISGSAWCNDGLCDGFCHEYSDGDPECVCKTDCHNRGTVDPVY
CSCSCDYGYVGDYCDAEGHDEDGSWFDGEWFPSQRGAVNGTDLCEIESCPSNLVFDLFNC
KCDCERGYFLAYGTCYDIDECATLDGVCEYGCKNFDGTYTCTCAVGFALDSNQRTCIELN
ECETGISGCSHKCFNTYRSYYCECDIGYQLARNRRECTRVAPEITSRSKASPCDGIANGG
CEQVCSFNDNVTCACRDGFELAGDKTTCLDLDECADNSAGCEYDCVNLNGSYSCQCPNGQ
ILSYDGHTCEADVCSMGSHCNGNGVLDKTTCQCHCSSGYDGTTCDVPCVSNMSNCWTTYK
EPTPMYDVDYCPVFCKQCGCFDFPVCRNGGMLNKVAGYEFDIDIGMCMCYCQYPWRGRTC
TECSIDCLNGGTLDKNRCLCECPVGWHGMACEKQCEEKSMLCTSRSQPYCETVALVAEKC
PILCGICGLA
Download sequence
Identical sequences Sakowv30024121m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]