SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30026439m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30026439m
Domain Number 1 Region: 562-825
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-61
Family Nuclear receptor ligand-binding domain 0.0000000209
Further Details:      
 
Domain Number 2 Region: 490-568
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-27
Family Nuclear receptor 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30026439m
Sequence length 827
Sequence
MGRSNLPQLSHSAFAVKLVSPSMRHLWRELEVDLAQGFKGNFSCYSVKVERRPEAVRGTV
NISTEPSARCSSVGSSVSSPAQPSTSQSASVATATYTEETGLVGSRTPSNDDTRSMPTLP
SSTDTMATAMEYGYQGSYMTGMLPSFQDTYGESFTFRNTEFAEPHTGYGEFFSSSSPYEH
AEQCHEDTPFELPSMHDVTPCAVYSYKPSSQTSPPTPAQQQSGGYGYSPKPSQSPPPTTP
SYGQQSGFQFSPKPNPHSPPSSQSYAHQPSYSYSPEPTSQSTTAGTASYASTSQQSYPYS
PKTNTHSPPSTPTAYASGNPQSGFHFAPITKQESSSPFSSQQGPQAQNRLQHSPITPTST
SYGGYGGLESHGSHVDPYEAENQECHWSDRASQGDIEHRIHGSRTPESHSGYIHIDMKLG
QYSPSGCYPIHSPLQGSPSPGMSMHLAGQPTFHGTFTMASTLAPMHHGTMKDITPLPSTS
QRNSPGQEGTCAVCGDSAACQHYGVRTCEGCKGFFKRTVQKHAKYVCLANKNCPVDKRRR
NRCQFCRFQKCLASGMVKEVVRTDELKGRRGRLPSKPRSPQESSPPSPPVSLITALVRAH
VDASPGKPNLNYTQFEMPDTSSESKLDDKEQLQQFYDNLVQSIDVIKSWTQKIPGWSEIC
EEDQELLFQSACLELFVLRLAYRCSPSDDRLAFCNGVVLHKQQCARGFGEWLDQVVNFAE
TMHGMDVDISAFACLSALVLVTERHGLREPHKVADIQNKIIGSLRDHITYNPVAHNRHNY
LSKLLLKIPDLRTLSKQGLQRLYYLKLEGAVPAPSIVERMFAPHLPY
Download sequence
Identical sequences XP_002735608.1.86028 Sakowv30026439m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]