SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30026442m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30026442m
Domain Number 1 Region: 447-710
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-61
Family Nuclear receptor ligand-binding domain 0.0000000209
Further Details:      
 
Domain Number 2 Region: 375-453
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-27
Family Nuclear receptor 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30026442m
Sequence length 712
Sequence
MPTLPSSTDTMATAMEYGYQGSYMTGMLPSFQDTYGESFTFRNTEFAEPHTGYGEFFSSS
SPYEHAEQCHEDTPFELPSMHDVTPCAVYSYKPSSQTSPPTPAQQQSGGYGYSPKPSQSP
PPTTPSYGQQSGFQFSPKPNPHSPPSSQSYAHQPSYSYSPEPTSQSTTAGTASYASTSQQ
SYPYSPKTNTHSPPSTPTAYASGNPQSGFHFAPITKQESSSPFSSQQGPQAQNRLQHSPI
TPTSTSYGGYGGLESHGSHVDPYEAENQECHWSDRASQGDIEHRIHGSRTPESHSGYIHI
DMKLGQYSPSGCYPIHSPLQGSPSPGMSMHLAGQPTFHGTFTMASTLAPMHHGTMKDITP
LPSTSQRNSPGQEGTCAVCGDSAACQHYGVRTCEGCKGFFKRTVQKHAKYVCLANKNCPV
DKRRRNRCQFCRFQKCLASGMVKEVVRTDELKGRRGRLPSKPRSPQESSPPSPPVSLITA
LVRAHVDASPGKPNLNYTQFEMPDTSSESKLDDKEQLQQFYDNLVQSIDVIKSWTQKIPG
WSEICEEDQELLFQSACLELFVLRLAYRCSPSDDRLAFCNGVVLHKQQCARGFGEWLDQV
VNFAETMHGMDVDISAFACLSALVLVTERHGLREPHKVADIQNKIIGSLRDHITYNPVAH
NRHNYLSKLLLKIPDLRTLSKQGLQRLYYLKLEGAVPAPSIVERMFAPHLPY
Download sequence
Identical sequences Sakowv30026441m Sakowv30026442m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]