SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30026674m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30026674m
Domain Number 1 Region: 84-363
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-61
Family Nuclear receptor ligand-binding domain 0.000027
Further Details:      
 
Domain Number 2 Region: 13-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-28
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30026674m
Sequence length 366
Sequence
MNKTATTSSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRQYVCKNKGNGPC
PIDKTHRNQCRACRLKKCVQVDMNKDAVQHERGPRNSTIRKQMALYLKETTGRDDVTATI
PSNLRHGPTFMNTLLGGESPYMGITYPYELTPSYCSNPEAICETAARLLFMSVKWAKNVP
AFLSLPFRDQLLLLEEGWRELFVLGAAQWQMCMEIGPLLAAAGQLHFRLSTEHTNPEKIV
AIMSEMRTFQEIIAKFKQMQVDATEYACLKGIVIFKSVFPDSPQEIRGVRDFHGVATLQD
QAQLTLSKYIHTKYPTQPFRFGKLLLMLPQLRAIRPSTIEELFFRKTIGNIPIERLLCDM
YKANDF
Download sequence
Identical sequences Sakowv30026674m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]