SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30026817m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30026817m
Domain Number 1 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000153
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 381-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000258
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 85-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000107
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 296-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000183
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 6 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000357
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 258-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000526
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  Sakowv30026817m
Domain Number - Region: 431-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000157
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 344-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0354
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 143-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0546
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30026817m
Sequence length 661
Sequence
MVPVMLMLLLLSASHHIDENDIADDDDDNETIDLDYEPDILGESGNEDEIGGADDPRDED
YEPKSGKQYQYKYKYKYKYKKSGKYKCEKCGLVTLNSAHLKRHMRCHLRIRPFKCTICSF
STSTGWNLNRHMKSHKKYSELISCPHCSYHGIKQSTVNSHISTEHPGEKNNTATQSDEGK
LHICIHCEERFTSTQELRTHSVSMHKGEKWKCDHCDYTTNRYTNARRHQQKHVKKVIKNP
STVDETKKNDSHVANQQWKCDQCDYATNRYSAIKHHKDVHDKLGHKSVTCPTCKCVFLSI
SYLRKHELQQHGKIPEKYKCTYCDQSFTWEIDLQFHKYLHEQEKPYKCPDCLTTNKSIAG
LKRHYFKDHHPEYGRCSAKRTLLCHLCGYHAISKFFLTKHMRSHTGEKPYKCDQCNFASA
TSFSLTRHKATHKSTNPYHCSECSFITNAQGLLTRHIRVFHGRKDFQYSHPDHNTYICDQ
CAAVFHRKSAFVTHQRIHSGERPYKCSKCNSSFRDKYVLKKHNLVVHEKCRPHVCQICSF
STTDSWKLRQHVQKKHGVQSGMMSKMLQQQRREDQNAAMTIFGTLQEESTSSNGQESTES
SDNQISIDSMETQNMNTTDPIMLNHPSPTWAHYNASSAAMDMIGMTTQAFPSTSTTTYHS
M
Download sequence
Identical sequences Sakowv30026817m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]