SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30027209m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30027209m
Domain Number 1 Region: 226-237,384-633
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-59
Family Nuclear receptor ligand-binding domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 140-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30027209m
Sequence length 645
Sequence
MEGTQVQTIETHVVQQQQQQQQQQQQQQHQQQQQAMDTSQVVHQHHQLHPSTVTVTTVGS
NVETTTSELSKEMQTAEGLARLRHEEVITKIIQVPHVQVLQGGHAGQMQHVTLQVPQIAQ
IQQVHPIQMSPDKVVSKPMDPCVVCGDKASGRHYGVVSCEGCKGFFKRSIRKQLCYTCRG
SKDCQVTKHHRNRCQFCRLQKCLAMGMKAECSKLSGTSRISNTSIAVQCERTPIKSNRDR
TSGNCAASTDKIYIRKDLRSPLAATPTFVGVEKEKQHIGLFDQGMLINIQGGSPSVEAST
ANTDLSTLANVVTTLANMSKNKEGTSQDGAGDSSQVANGETGTTEIQASAEAVNQISKAF
DTLAKALNPQGDATETANTVEVTTSDSANGSGQGDGSDQSLPLVELEGPLLSETHFQFKL
TTPSPMPQYLNVHYICESASRLLFLSMHWARSIPAFQALGQESHTTIVQKCWSELFTLGL
AECSQAMALSAILTAIVNHLQTSVQQDKLSADRVKVVMEHIWKLQELVNSISKLQVDSSE
FAYLKAITLFSTDHPGLVNPRQLEKFQEKAVQELQEYVTRAYPASPDRFAKLLLRLPALR
LLTPSIMEELFFAGLIGNVQIDSIIPYILRMETADYNTQIAVQPQ
Download sequence
Identical sequences Sakowv30027209m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]