SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30027216m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30027216m
Domain Number 1 Region: 150-162,309-558
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-60
Family Nuclear receptor ligand-binding domain 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30027216m
Sequence length 570
Sequence
MEGTQVQTIETHVVQQQQQQQQQQQQQQHQQQQQAMDTSQVVHQHHQLHPSTVTVTTVGS
NVETTTSELSKEMQTAEGLARLRHEEVITKIIQVPHVQVLQGGHAGQMQHVTLQVPQIAQ
IQQVHPIQMSPDKVVSKPMDPCVVCGDKASAVQCERTPIKSNRDRTSGNCAASTDKIYIR
KDLRSPLAATPTFVGVEKEKQHIGLFDQGMLINIQGGSPSVEASTANTDLSTLANVVTTL
ANMSKNKEGTSQDGAGDSSQVANGETGTTEIQASAEAVNQISKAFDTLAKALNPQGDATE
TANTVEVTTSDSANGSGQGDGSDQSLPLVELEGPLLSETHFQFKLTTPSPMPQYLNVHYI
CESASRLLFLSMHWARSIPAFQALGQESHTTIVQKCWSELFTLGLAECSQAMALSAILTA
IVNHLQTSVQQDKLSADRVKVVMEHIWKLQELVNSISKLQVDSSEFAYLKAITLFSTDHP
GLVNPRQLEKFQEKAVQELQEYVTRAYPASPDRFAKLLLRLPALRLLTPSIMEELFFAGL
IGNVQIDSIIPYILRMETADYNTQIAVQPQ
Download sequence
Identical sequences Sakowv30027216m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]