SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30029859m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30029859m
Domain Number 1 Region: 97-364
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-51
Family Nuclear receptor ligand-binding domain 0.000000354
Further Details:      
 
Domain Number 2 Region: 17-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-27
Family Nuclear receptor 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30029859m
Sequence length 367
Sequence
MLDGPRKKTKQKRGKNLPCAVCGDMAQCFHYGVAACEGCKGFFKRTVQKSSRYLCLEKQS
CRVDKRRRNHCQYCRFQKCLEVGMMKDVVRKDGLKGRRGRLPSTDRRQSHGTINSPSSPI
SLITQLVRAYLDTSPTTSSLDYSQFQEPPKVKTVEWKTSMLVSKPSDPHERLHQFYDNLC
ASFHLIRLWSEKIPGWNDLQRQDRDLLLQTATLEVFILRVAYRYRPIKQHVVFCNGKVHH
RCQAMLGFGEWLNYIIDFCEQVHKMDIDISTFACLNVLTLVTERHGLEYPKQVEMLQDSI
IESLQDHLMNSAATENRDNYLSKLLLLIPELRTLSKQGLHRLYYLKLEGGIPAPPMVNKM
FQPDLPY
Download sequence
Identical sequences Sakowv30029859m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]