SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30030797m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30030797m
Domain Number 1 Region: 3410-3457
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000205
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 2 Region: 1722-1855,1897-1979
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000266
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Domain Number 3 Region: 2101-2328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000484
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Weak hits

Sequence:  Sakowv30030797m
Domain Number - Region: 958-1004
Classification Level Classification E-value
Superfamily UBA-like 0.00785
Family TS-N domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30030797m
Sequence length 4620
Sequence
MSEEETSSQINEDDVKNLSSCLEDTNSVLTLLKTVMNKSYIDSYDILCCICNLYAACYSY
TMTKIPQNKRVTRQTSKNTEIDKMKEMYDSVISSMHQWIHTKLPYSLFSSWECGSKTDYT
NELKAKPSQKVKLFCRKDVQDYHPTVQKTLSDAAFSAVGEICKHAKDSEDLFRTINQSEV
NEYGTLLSHMLEKSWPAPNHGENCASFKQILQHLLTWTPFVGFFKMTGASQGHGNILSTL
AQEHVAISQSVLDSLTQELLSGAIQTDDLNMVLNNINHFLELYKVTGGETIPSKEQGCHR
PDFPNITKILDHRKKELEAFEHDRKLISSFLGICQSIQPVDIQQLQEKVEVNIDELKLSD
VCNPIKLDQIGTRLLEVTFFGLSLAVKKMLEPLQKIHSSSLFQNMWISRAKTQHKEKQKR
SGTNILSIDEVAVEVWQFVFREIMEVLTKTQTGSLTLKEVDTLFGRFRNHYDQLEKELMQ
LLGARSKADWIKDRMVQIKQYHQLEDRLDAVGTIINIKKTFGLSGDFNAVLLLSSVRDAD
FKDRKLESINHEVVTAGIALAEMSHARILCLQELVKQKALVDWLRTEIKDVQQLKVFVDL
AMISAGETDMEVDRVKCLHQATTGFSSFIFDLKPDAGFHQLMKACESLWNALRNDEDLPE
KLRGVSHHLDWLKGVKESHGSVETSSLSQAEAINTKGIYVVGSIDKNAVDTLESVISLHF
QSDKDSTMNNDDHDEKTVIKDKKYNLDMLRDLQSKLMLVAGKAEQGRDAVERFTEILSGI
VQLADLYIKLCAAGNVLFSEWKALIYCGKRKVSVMVDFGFGDSQDLMGTKDVIVQLDELC
HFMENCLKEWLEYVEEKRSEIYQLNYFTTEQLVILRRELSKLMSNEKEMAAGVYTLLASL
KDSCTESDVKEALNAAFMEVGSQNYQEEMEMEPIEVKPELEKMTDMPEECGVDLKKVKAI
LQELVDEGLSEVQAKAAMQACGPAVDIDDAMAWYYQNMQDEKLMARLCKEWEDDMEMKLF
GNGLENSTPAAERASPTIPNVQTPSVTTTSGSLVDSSHQAKQEKKVRSLSKITSSLLTGL
GKSKGDLIKKLQQLWKDYQISLTAVSLEDYLSLEHLGHTLQYLATKDPVELNRNFPKYLN
TGKPNLVVRRKDEILRDVLSIYMADKDKPLPSYDEVLICTPQTTLEQVVLLWRRAMFDNS
GKIYCLVNADQLDYDISTTAEVKRNQLTQDTRRNTDYRLMVLCSREQEDHSHMVTALDSY
RIDASRLPFVKDIQTYLKEQFIRQASSQMTAVPVANLTHNRCCVQVLISERAGVGKSLAV
RRLTEKLIEVHKPMKDACVTVPLAEKKVDVNAMVSVLGDYITKPVRPDPKIFHLDITPAV
QHGVDNLLFNLLVLGGITDTHGRVWRRYPWDLYVIEITAPSQAVNTAEAAVPTGCQETKV
FHGHQFHTLLPTRTCRSPRVTLELESSMARSMTINDPLMDNLEFTSNAYQRAYQYLKRHS
KGANLDFYDFEEGKIEDNHATCLDVLLRHCGVLDPSWAELRHFVWFLNEQLNDCESSVFC
NHVHLGDASLNGFKSFVVKFMVRMSKDFATPSLQMSDQSTACLQMDIDNDDDTGDDIASY
QLRRRWESSPHPYIFFNHDHISMTFLGFVIDQNGSLVDPSNNQIIEPSIMTREVRRGLEL
QRVNLRVRFDDLSRDDKINQLCQVMGIEWAFDPDNTYELTTDNVKKILAIHMRFRCGIPV
IIMGETGCGKTRLIRFMCQLQAGAVAVDGPKNMVLMKVHGGTTANDILRKVEESEKLALH
NKERHKVDTVLFFDEANTTEAIGLIKEVMCDQRMNGKPLTHGSNALKIIAACNPYRRHTR
DMIERLEMAGLGYHIRAEKTDDRLGRIPLRQLVYRVQALPPSMLPLVWDFGQLNSEVEEL
YIKQIVARYVHSGQIPVGSEHVISSVLAASQRFMRETESECSFVSLRDVERAMNVLVWFY
KHKEVAILLKDQFYEDHMEDDVDEEEEEDEEPDEYEPLDYLTQALVLSLGVCYHACLQEE
REAYRNNISKYFTHPCVLTEGGDQMLEEINRCQDVFLKQLKLGPNIARNAALKENVFMMV
VCIELRIPLFLVGKPGSSKSLAKTIVADAMQGEAAASPLFKTFKQVHMSSYQCSPLSTPE
GIVGTFRQCSRFQEGKDLNRFVSVVVLDEVGLAEDSPKMPLKTLHPLLEYGCDDEDNPPP
HKKVAFIGISNWALDPAKMNRGILVSRGVPDEDELKDSAEGICSTDEIVLSRIQPMIPAL
AKGYLKLYKIQNKEFFGLRDFYSLVKMVYGFSKASGDPPTWRQLVHAIRRNFGGLDDIDP
VKVFNKQLHNVDKRQERGPNDPDCDPAGLIRASLVGLDRGILNMESESRYLLVLTENFAA
LGILQQQLLSMEDTVIIFGSSFPKDQEYTQVCRNINRIKVCMETGRTVVLLNLESLYESL
YDALNQYYVYFGGQRYVDLGLGTHRVKCRVHNEFRLIVVADKDVVYERFPIPLINRLEKH
FLAMATMLTPGELEVVDRLEKWVKSFATITQSPHQRDRSKGRFKIHDAFIGFNNDTIASI
VLQVTTDMNQHEGNQKWQEHVYEQSQELLLYCATPDSVARLTKSGLCSSSERLWQKYFKE
QKHNSVAEYLEYQVSMAKRSGNMVGIFAQVTTHSRLLSRYDIQDLARNIGLHPKLLLQHS
VFLQALHTEQQFTKHVRAFFTDTDASKMERLLLVQCDAGDENTNLIACSRYIVQDERAQA
MKHNDNWQLAHVVFIIQLPRVAGGCFDGLQGGKWLAAHIDDLRPPLSSHPEITALQNQSM
SAVFESDIPKRQQLKKISPSDSGIQISEESDDIMESETTGISVELVDGIIEKGQQMEVES
RGEEAMEVATCEGDSLETAGLLNIAGFIGKVQEVPSCAVEVPGIDGEMMDVDVSDKLGLL
DTRALLKCCIQSAAVMLEDEECRKHRSTGRIDILLELFKREGNKPNQLNFVEILKERIFQ
LLKEKDQRSPDPTQWLCKEALTGESVQTNGTFRRAIWQSLVSTVTPLLAQVIGFADRNDN
LDLILKSPSGSWIHQLWLQILRNQKLLEMTYESFLSPVKNTPREIVPVLASGVNGSFFTA
HCPFSWVIKQFVEEKWEEAQNMKASTGQHNIEVTFTDLLMEAELGQTMLNNLLDSDFNEF
MNSYLHDFVRMVYKASNDHEYEVVCRAIHIASIEYHQVEGFEEFLFAVPQVHMSYHRIRG
RLDSFFQIAHFLPSDIRERIPAEQENQVVVDALALIALMESLEPKKDELNDNANRERWLR
RVKDAGPVVERVLDAEIQDTIFYGEISRTHIQHCRPLWVRLCVLKLFVEHVCPPKTKVGD
ENIKHCYRLMKALGVGVNLKSVQSVTTIENFLRKCNETASKVHFKYGVQDCGICLEAINE
PVALPCDHVFCLKCLKDLFRVKETRTCPRCRAELPKQYRLESSEKCKKVVDAHNAFRQRC
NAFFMEIVSRYCFADNGAPEPEVVSKLMSYVTRESEIKGRQSKGFTPFIEDCIDPNPIVR
SFLLQLLLRSSNCQVYVHLQKYFDTARHLVKSKAEIIELCLLCIQCIEDSYHNQSVQSCS
DATLAILRGAITKIGDSIQQSQHDEGSIGVTQLQSVAGVRFGLVTAAEVIYKFFGGSRQR
NQMEIDANQTQFKLAEELLDITAKFFTSCGSKWPRVFLVKQICRRYGIDCLHGLLTNPNL
KWIAPPEAQQQVEVIPDRFVTCGKVYQDLREAMATALLDGRFEKVKEIIKRCTKKREYKE
ALLMLAIYREFTMSYANTQMPVDDQVAQNLVTFIEKSNSIQKEGLAKDLVFNRQGGKCTH
LKVVANQQPLHRTLAAIVVHAMSVLQCSGQNNVTDPLVALMVNPQSMNNAYFPTMHEDLL
LEAMEAVKDGKKWYECQNGHPYTIGDCGNPASVSRCRDCNVPIGGQGYKLEQGNRQARQQ
DATQTGHILGAPEKRHNELPIPERQMPPVATAIVRLLMHASMLAGATKSPKDVSAAIDPH
ITPNGVHMFLWQHLQYDLHLLSRSSGKSVDDAALTVHMVLHRILKEKPLDGQHFDGHLKT
KKSRANWEDIFTRSYISPVVEDLARKLQVANHKVQNDKRLGNNPLLRLLYEVDPPSEKLT
IKSLYNVPTVWRYRSRVTIEHLTHALQENTAGCKKHFPILQEFLDKEYKLRALKYLPDIV
HLQQLLIDEYHRNIDIHEATNLKIGKFLNKLPRGHVRDKYTRLIKSFSLAWNLVRNEIAN
YGGLYVSKELCSQPIDENSSIAMVLPTRKADGVCSTALVDFLIITQNEFIDQYVRICKVD
SSDDEILPCDLTPAHLIAYDPEKDLLPIVLSHCSYSLQVGRGTLVEYNLSGLERQLEERF
IHGKAKIKRKIEQLVFRQDSRDAAVFESLRNRIQQESLSKAIQHQIVTEMKSLTDVCDSL
ACLDIAIGFLASSGGKADMYIIKYLVDTLKMDKENMKVRHSCQLKHILSLWQLLAVEKAR
RLTLNSQDPFDIRDFRDQLTEGQIENLQQALQHIQVDALVNELHDYIVIGLEKQKNLMQD
EQQDVDNWKLSEILPVYIENKEGEPITGFVEHFPEDILIKHIMSTWEEVIKYQYKDASRR
Download sequence
Identical sequences Sakowv30030797m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]