SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30030798m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30030798m
Domain Number 1 Region: 3170-3217
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000915
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 2 Region: 1469-1602,1644-1725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000465
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Domain Number 3 Region: 1848-2061
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000783
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30030798m
Sequence length 4380
Sequence
MLDSILESILRGQIRIFYLNVLLENNNHFVELCKTIVIKTDLQKERGAATNMQPSTQDII
KILGRRAKELKAFETERKQISCFLGICETIQPVNLQALQAKLDSDVDGLMLTDICEPITL
SRDSNKPTITYFNISPVVKQMLPPLENIHSSVLFQDLWQAKARIVHKEKSKDTGDDVLTV
DDVANKVWKKVFGHISEIISKLQDGSLILKEVDEFFGRFENEYDQLENELKLLLGPRPCD
WLKRRIQQIIHYHQLEQRLEAVEIVQDVKKTFNLTGNFTAISVLSSVRNADFKDRKLESI
DDDVVNAGKSLAAMSRERILCLQQLVLRKDFIEWLRKEITSIQQLKVFVDLAMISAGETD
MEVDRVKCLHQATTGFSSFIFDLKPDAGFHQLMKACESLWNALRNDKDLPKKLKDISHHL
EWLKGVKESHGSVETSSLSQAEAINTKGIYTVGNIDYNAKDTPESVIRLLVQGDDSLMED
DEDEAASKDKNYNLDMLKDLQSKLMLVAGKAEQGRDEVERFTEILSGVIRLATAYLKLCA
AGNVLFSEWKAIVYCKYKKKVSVMVDFGIDGSHDLKGTREVTTELDKLCSFMENCLKEWL
EYVEEKRSEIYHLNYFTTEQLVILRRELAKLMSNEKEMAAGVYTLLASLKDSCTESDVKE
ALNAAFMEVGSQNNQEEMEMEPIEVNASMETPELEKMMDMPEESGVDLEKVKKFLQELVD
EGLSEVQAKAAMQACGPAVDIDDVMAWYYQNMQDEELMARLCKEWEDDMEMKLFGDGLDD
STPAAERTVSTMTNVQTLSVTITRGEKVSSLSKITSSLLTGIGQSKGDLIEKLQQLWKDY
QISLTAISFDDYLSLEHLGHTLQYLATKDLVQLSRLFPKYLNTGKPNLVVRPKDEILRDV
LSIYMADKDKPLPSYDEVLICTPQTTLEQVVLLWRRAMFDKSGKIYCLVNADQLDYDIST
TAEVKRSQLSQDTRRNDDYRLMVLCSREQEDHSHMVTALDSYRIDASRLPFVKDIQTYLK
EQFIKQASSKMAAVPVANLTHNRCCVQVLISERAGVGKSLAVRRLTERLIEVHKPMKDAC
VTVPLAEKKVDVNAIVSVLGDYITKPVRPDPKIFHLDITPAVQQGVDNLLFNLLVLGGIT
DTHGRVWRRYPWDLYMIEVTAPSQTANTAEAAVPTGRPETKVFYDHQFYTLLPTRTCRSP
RDTLELESSMEHSEELAMTINDPLMDNLEFTSNAYQRAYQYLKRHSKGANLDYYDYEEGT
IEDNHATCLPVLLRHCGVLDPSWAELRYFVWFLNEQLNDCESSVFCNPMLVGDASLNGFK
SFVVKFMVRMSKDFATPSLQMSDESTACLQIDMDNDDDDTDDDIAAYQLRRRWESSPHPY
IFFNNDHVSMTFLGFVIDQNGSLVDPSNNQIIEPSIMTREVKRGLEMQGVNLKVRFDDLT
RDDKINQLCQVMGIEWAFDPDETYELTTDNVKKILAIHMRFRCGIPVIIMGETGCGKTRL
IRFMCQLQAGAVAVDGPKNMVLMKVHGGTTANDILKKVKESERLAWLNKTRHNVDTVLFF
DEANTTEAIGLIKEVMCDQRMNGKPLTHGSNALKIIAACNPYRRHTRDMVERLEMAGLGY
HIRAEKTDDRLGRIPLRQLVYRVQALPPSMLPLVWDFGQLNSEVEELYIKQIVARYVHSG
QIPVGSEHVISSVLAASQRFMRETESECSFVSLRDVERAMNVLVWFYKHKKIAELLRDQF
YKDLEEYEDEDEEEDEVPYVSAPLDYLTQALVLSLGVCYHACLQEEREAYRDNISEYFTR
PCVLSEGGDQMLDEINRCQDVFLNELLLGPNIARNAALKENVFMMVVCIELRIPLFLVGK
PGSSKSLAKTIVADAMQGEAAASPLFKTFKQVHMSSYQCSPLSTPEGIVGTFRQCSRFQE
GKDLDRFVSVVVLDEVGLAEDSPKMPLKTLHPLLEYGCDDEDNPPPHKKVAFIGISNWAL
DPAKMNRGILVSRGVPDEDELKDSAVGICSTEDVVLSRIQPMIPALAKGYLTLYKDQNKE
FFGLRDFYSLVKMVYGFSKASGKPPTWHQLVHAIRRNFGGLDNIDPVEVFNKQLHNVDKR
QIKGPTDPDCDPAGLIRASLVGLDRDILDMESESRYLLVLTENFAALGILQQQLLSMEDT
VIIFGSSFPKDQEYTQVCRNINRIKVCMETGRTVVLLNLESLYESLYDALNQYYVYFGGQ
RYVDLGLGTHRVKCRVHNEFRLIVVADKNVVYERFPIPLINRLEKHFLAMATMLTPGELE
VVDRLEKWVKSFATITQSPHQRDRSKGRFKIHDAFIGFNNDTIASIVLQVTTDMNQHEGN
QEWQKHVYEQSQELLLYCATPDSVARLTKSGLCSSSERLWQKYFKEQKHNSVAEYLEYQV
SMAKRSRNTVGILAQVTTHSRLLSRYDIQDLARNIGLHPKLLLQHSVFLQALHTEQQFTK
HVRAFFTDTDASKMERLLLVQCDAGDENTNLIACSRYIVQDERAQAMKHNDNWQLAHVVF
IIQLPRIAGGCFDGLQGGKWLAAHIDDLRPPLSSHPEITALQNQSMSAVFESDIPKRQQL
NKISPSDSGIQISEESNDIMESEMKHMPVDVKLMNLNLEEGQQMEVESGGDEIIEVAPCE
EDSLETAGLLYEAGFIGKVQEVPSCAVKLPGVNGEIMDVDVSDKPVLLDTRALLKCCIQS
AAVMLEDEECRKHRSTGRIEILLELFKREGSKPNQLNFVEILKERICQLLKEKDQRSHDP
TQWLCKQALTGESVQTSGTFSTVKILIVITFHRRAIWQSLVSTVTPLLAQVIGFADRNDN
LGLILKSPSGSWIHQLWLQILRNQKLLEMTYESFLSPVKNTPREIVPVLASGVNGSFFTA
HCPFSWVIKQFVEEKWEEAQNMKASTGQQNIDTTFAELLLEAELGQTVLSNLSNSDFSEF
MHSYLHDFVRMIYKASSDHEYEVVCRAIHIGSFEYHQAESLEEFFFAVPEVHMSYHRIRG
RLDSFFQIARLLPVDILERIPAEQEMQVVLDALALIALMESLEPKKDELNDNANRERWLR
RVKDAGPVVERVLDAEIQCTIFYGEISRTRIQQCRPLWVRLCVLKLFVEHVCPPKTKVGD
ENIKHCNRLMKALGEGVNLKSVQSVTTIENFLRKCNETASKVHFKYGVQDCGICLEAINE
PVALPCDHVFCLKCLKELFRVTDTRACPTCRKEVSKHFRLESSAKCKEVVDAHNAFRQRC
NAFFMEIVSRYCFADNEAPEPEVITKLMSYVTRESEKKGRQSKGFTPFTEDCIDPNPIVR
SFLLQLLLRSSNRQVYVHLQEYFDTAQHLVKSKAETIELCLLCIQCIEDSYHNQSVQFCP
NATLAILRGATTKIGDSIQQSRHDKSSIGVTQLQSVAGVRFGLVTAAEVIYKFFGGSRQR
NQQEIDANQTQFMLAKKLLDITAKFFTSCGSKWPRVFLVKQICRRYGIDCLQGLLKNPSL
RWIAPPEAQQQVEVIPDRFVTCGKVYQDLREAMATALLDGQFKKVKDILQRCTEKREYKE
ALLMLAIYREFTMSYANTRMPVDDQVSQNLITFIEKSNAVQKERLAKDLVFNRQGGKCTQ
LKVVANQHPLHRTLAAIVVHAMSVLQCSGQNNVTDPLVALMNNPQSMNNAYFPTMHEDLL
LEAKQAVKDGTKWYECQNGHPYTIGDCGNPASVSRCKDCNVPIGGQSSKLERGNRLARQQ
DATQTGHILGAPEGRHNEMPIPERQMPPVATAIVRLLMHASMLAGATKSPKDVSAAIHPA
INPNGVNLFLWQHLQCDLHLLSRSSGKSVDDAALTVHMVLHRILKEKPLGGQHFDRNLKS
KKSRANWEDIFTRSYISPVVENLARKLQAANHKVQNDKRLGNNPLLRLLYEVDPPSEKLT
IESLYNVPTVWRYRSRVTIEHLTHALQENTAGRKKQFPILQEFLDKEYKLRALKYLPDIV
HLQQLLIDEYHRNIDIHEATNLKIGRFLNKLPRGHVRDKYTRLIKSFSLAWNLVRNEIAN
YGGLHVSKELCSQPFHENSSIAMMLPTRKADGVCSTALVDFLIITQNEFIDQYVRIRKVD
SSDDEILPCDLTPAHLIAYDPEKDLLPIVLSHCSYSLQVGHGTLVEYNLSGLERQLEERF
IHGKAKIKRKIEQLVFRQDSRDAAVFESLRNRIQQESLSKAIQHQIVSEMKSLTDVCDSL
ACLDIAIGFLASSGGKADMYIIKYLVDTLKMDKENMKVRHPCQLKHILSLWQLLAVEKAR
RLTLNSQDPFDIQDFRDQLNLLQIQKLQQGLRHIHVDALVNELHDYIVIGLEKQKHLMQD
EQQDVDNWKLSEILPVYIENKDGDQITGFVEHFPEDILVKHIMSTWEEVIKYQYKDASRR
Download sequence
Identical sequences Sakowv30030798m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]