SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30031182m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30031182m
Domain Number 1 Region: 35-325,380-455
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-72
Family Ras GEF 0.0018
Further Details:      
 
Domain Number 2 Region: 545-606
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.05e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 482-549
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000368
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30031182m
Sequence length 765
Sequence
MAGYVAEHVNGDAANSWHGRTTITEFIEDDKPVVPGLTFKAASLDKLITYCIESLDDNGD
LVEKSPFPRVFFLMHKWFTPSEELATKFLELYKSYPGVCCKSSCLHRLEDKDCKRYQYRC
RVCQAVRYWISHFPVHFDLDKNLSSVVWTLQRHIQEDGCTKLKNVVDISSIPSYDWMRHI
SVRNSTIRHNRKVSLVFNHLEPNELADHLTFLEYKIFRRLTFSDFKSYASHKQLKDNPKL
ERSIALFNGLSQWIQCMVLSRTTPKQRAEVVTKFVDVAKKLRLLQNYNTLMAVVGGLTHS
ALARLGKTNAHLSSETLKVRYIRCINPSSIHLPSDALKLLWNTSRRAGESSYSQGNDTNS
TLSNPEQPSTCRTLADMTDLLSSAGNFCNYRKALQESVHLKDLITLHTAFPDRLENDLIN
FRKMAQLSMTIEELTQLQNATPPIEANMDLVNMLKPPTPTKPAVFADWASGVNTPPDPET
INKHVHAMVEAVFKNYDNDRDGFISQEEFEAIAGNFPFMDSFCVLDADKDGMISKSEMKT
YFIRANYHALRSSFKHDFHEHTYFKPTFCAHCTGLLWGLIKQGVKCKTCGINSHKHCKDL
VVMECRSKSSASTHGHTNGSVDGVPAKDVTMDCKRKMSIRHKQTRANQQAAQAKEESIKE
NKEKKDATDQKMLAEEEKIDRQEEDDIDNYGESYEGETDLEERLSRAEQARDLLSTENER
LQKQLHTAEEKINTLQSHISLIRQHTITFILDQMDTLHLQKDSEV
Download sequence
Identical sequences Sakowv30031182m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]