SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30032191m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30032191m
Domain Number 1 Region: 123-368
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-53
Family Nuclear receptor ligand-binding domain 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30032191m
Sequence length 376
Sequence
MSKDAVKFGRMSKRQREKVFKELEKLDIQRIKRESEPDVRATELSTSSPSRTSPVMKSQG
HSQPMRSPLSMSSVYTFPSQPMQSSPTTVPVSLHQTPTSTLAHHPPSVASGPLNIDPRQA
ELDQLTTAVTISHHQTCIYSPAQLSAMRASAEDSLKVKSEPSWFSHSQTKDEVWLKMAEY
LTSHMTRIIHFAKMIPGFLNFCQEDQIVLIKSGGLEVILIRLGRLFDVTTGTFPMWDGNF
TLEHLKNLAGVISHDCFFESMFDLARNISSLSLSEEEIALFSAVVLITGDRQGLRDRRSI
EQLQEKILECFTKILHRNHPKEPGLLAKVLMFMPTLRTISTSYAELMNRALQENPHLQFP
ALHVELFSDIPEQDAS
Download sequence
Identical sequences Sakowv30032191m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]