SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30032564m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30032564m
Domain Number 1 Region: 637-720
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 291-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000243
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 3 Region: 206-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 250-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 466-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 555-591
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 7 Region: 1400-1452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 8 Region: 426-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 599-638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1005-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 385-419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 514-551
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1061-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 14 Region: 1521-1557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 15 Region: 83-173
Classification Level Classification E-value
Superfamily SEA domain 0.00000968
Family SEA domain 0.0063
Further Details:      
 
Domain Number 16 Region: 1459-1506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family Laminin-type module 0.059
Further Details:      
 
Weak hits

Sequence:  Sakowv30032564m
Domain Number - Region: 1128-1164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family Laminin-type module 0.03
Further Details:      
 
Domain Number - Region: 1757-1795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30032564m
Sequence length 1813
Sequence
MYIGIWAAIRATLLYSLDGEAVFDEKTQSCLLFSVLDESFNGEADVDGKAHLCLVVVVLD
EPSNGEADIDKKAQSCLLVGVLDVSSSFYRVVIRILNIDYSENLSNYTFEEFNQLAAGIE
QAIQQLYVGVPGTQTATVIQFQPGSVIVRIDLSTKDNYDEDQLRETLEAAVNNRYIGEYY
VDPNPDHFKFMPVGVIDRGFTESPIVPCYGDQFQCNNGDCIPDSRYCDGYRDCYDGSDEL
NCPLPTPPAECRNDEFGCQNGQCIPAYLRCDRRRDCRDGSDENDCFIETQPPPSVSAIDT
QATTDSILVQWIPRTNTDINLRGYTLGLSVGTRDVYTVTLDRQVTQYTIENLQPSTVYLV
TLRTFNNFGQSLPTIEVVSTESSIINCSPGEFQCQNQLQCIDERRRCDGRSDCNDGSDEQ
LPSCPVRCNSQEFTCADLRRCIPIIQHCDGTNDCADNSDEYNCPEVCITGQFQCLSGQCI
GSIQYCDGYQDCPDNSDEADCPQPIPTTTIAAEPAKCSRNERMCRNGQCVKNDYFCDGDF
DCDDRTDEENCAAPSSCEPNEFECRNQQCAQKIWKCDGEVDCLDGSDEFNCDSKDPNSRC
ESFQYMCLSGDECIPKSYQCDDEIDCRDRSDEIGCGPPVIITPPVEMVKVSEGETIILTC
KAEGIPTPIISWRLNWGHIPDSSRVTVTSINGLGVLTIKDVHESDSGAYTCEAMNNKGYL
FALPDAIVIVTPPEGHCTGSLFNAEAVTVAECVSCFCFGIAQICFSSTYNVFQETLDFTQ
PGIIFDMKLVKRRTTSIEPIDDIFLGVNTATAELYVQDITTQIGQGEYHWMLPQQFLGNQ
LTSYGGLLQYMVRYETNDFPKSSNVPDVVLQGNGIRLVHHIREQPTAGVQNSRKVELTEN
NWDRIDTGRGDIPITTPATREDLMMVLENIDTFMIRASYQPLMTYTSISDISLDFAVPRP
TGQERAVLVEDCTCPLGYSGLSCEDCAIGYRRVENNQYLGTCVECNCNGHASQCDQDTGV
CRGCRDNTVGAFCDTCANGYYGNAITGQCLPCPCPLTTPENQFSPTCYMDADNLPTCDSC
PVGYTGRNCERCAPGFEGNPSQPGDSCVISSGGVVNCDERGGDNLYDGRCQCKGNTFGES
CDQCQPNTFYLSSDNPDGCISCFCMGITNQCQSTSQNRAQVFSSFSSPEDVQGFSLVNRA
GTPAADAQLAINPASQELLFSGFRTLSPGVYYYQLPAKFRGDKVSSYGGYLRYTITHRAS
PGSSPMNEPDVMLQGNDITLYHYSEKSVSTNGITAYQVPFYETYWKRRDGAPAMRVMLMM
ALADIDLLMVRASLSTHMFESSVKDVSMDIAEPRNTGQPQAYPVEECSCPTGYRGLSCED
CELGYTRSHGGLYLGMCMPCGCNGHARECDSETGECRNCLHNTEGPNCERCIHGYYGNPS
SSTNSGCLPCPCPLTSPQNQFSASCYLDADGLPTCNACQPGYTGRNCERCVSPLQGDPTV
PGETCSEQSSGGGGGADCPGGQCPCKANTEGPNCNVCIPGFFNLDENNPDGCTPCFCAGI
TDQCQSSNYYRANTAVRFDSLTNNKNIVLQNRARTQTISTGFTMNPDNNEIIYSEFSSLP
PDTYFWSLSPKFRGNQITAYGGYLRFTLFFTASTNGRETYDVDIGIEGNDIYLYHRLYPS
VKPGERKQFEIPVTEDNFYRFDGEQTTREHMLMVLADVSYIHIRASYDELMLTSALGDLA
METAIPRDNGKRRAVEVEQCSCPEGYMGLSCQSCSPGYSRTGGGLYLGLCVKCACNGHST
ECDPDTGACVTKH
Download sequence
Identical sequences Sakowv30032564m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]