SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30035171m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30035171m
Domain Number 1 Region: 204-443
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-67
Family Nuclear receptor ligand-binding domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 83-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.08e-28
Family Nuclear receptor 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30035171m
Sequence length 444
Sequence
MVKSEPSDCAYDPSDSQYDITSPSHSSSSSSPVVIAASVVLANTVPLPMKSPPPNYNMAS
PQSDDSDSTSAKRRKGPLPRTDLELCLVCGDRASGFHYNALSCEGCKGFFRRSVTKNAVY
KCTRGGRCEMDMYMRRKCQECRLRKCREVGMLPECLLTEEQCKSKRQRKMVKQQLTKPQP
QPSNEGSNSFENNPSSQSEPAIDLTDEQKEIIVKITQAQRELEIPGPDDMRKVTPWPEEQ
SQLTEGEKLHMRFAHITELTILTVQLVVEFSKRLPGFIDLNREDQIVLLKGSAIEVLLLR
AAMRYIKEDDAIVFGNGLPYSRDTLCDGGIGDIVDPMYEFSRGMVDLDLDYGDFTVLMAI
VIFSADRAQLTDRESVEKIQEKYLEMLRTRLKMRRPNDALVLPKVLMKLTELRSLNNSHS
EMLFALKLQDQKIPPLLAEIWDVQ
Download sequence
Identical sequences Sakowv30035171m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]