SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30035351m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30035351m
Domain Number 1 Region: 130-186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 400-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000461
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 3 Region: 364-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000643
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 322-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30035351m
Sequence length 703
Sequence
MVTSGGDLKSDDVNNITVDAIVTSSSLGTDISGSGLWDIEIYLQDSNGDNYTVDSPTLSS
DESNQTLLSGGEIRFNDIEFSVNGSEIPCSDSLEVCVILRKGISPNPDFELSGVQNEISL
TGCQSVTCGTCQDPGSPVNGRQETGASFVNGGVVEFVCDLGILVGTNQITCYDGEWNDVI
PSCAIVIINNVMVTVTSSNELNGNGINDVFLNIAATSSILGSDVTGTDLWGLEVFLQNTE
GDMNVPFVPQLTSEEAGQRLSPGDQILFNGIQYTVDGSQIPCDETLEVCVTLKKGNSPSP
NFVLSGDPDDEALTGCQSMSCDVDECQDPDICPPPNHVCENVPGTFYCRCAGGYSGEDCH
VTDNCVPVNPCQNEGNCTSSLNSYQCQCASGFGGIDCGEEIDYCDPNPCQNASICKNSTF
GYKCECRLGFEGDVCNETVPYFTVCPEGETRVYTLEANSTHAYVNITLAAEDWLQRNLTV
ESVGHDVTLPGTVEFSMDFRHGREVWFRATDENRNIAYCVFMLQLIDAEPPDITCPVNVF
LTTTRTSDAAVWPLATAHDNIGLHPIKPITYNRQNGSELFAGEQRHHVTATATDSSENTA
SCNFTVSLRKTEEPPKTSPLTAIIAGSILGIVALIIIVVFISVLICHRRTAHDDSKAYMH
DRSRHFQDQIDMKAQNRSNYYGQGQQQTSHNGTFDNPTIDIHR
Download sequence
Identical sequences Sakowv30035351m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]