SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30037801m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30037801m
Domain Number 1 Region: 157-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 2 Region: 97-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  Sakowv30037801m
Domain Number - Region: 194-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0055
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30037801m
Sequence length 626
Sequence
MAIGERKFHHFHHFYRALWTVFLVIIALISLIEIVFIVTTYLSYPSRTEVVMVTREQAPF
PSVTVCNVNRLRRSAVANSQYEQLLSLDSLGSISHLMPYMGPCLSGDFECGGECVKWYMQ
CNGVEECRNGEDEINCASDTVIPYGGSRLNCDGGDAVFACDNSECVSSVQQCDYFDNCGD
GSDERNCTYYDQDCGSDGVTCFESDTSYCVPADLVCDRIKHCRTNGEDENNCDYPDIGSN
DLFSANWEDSYLHLTDSDDFYEDFRENIYREPVYGDDGKLSLINTLLLSRSSRVNDVIEQ
TVKFNTEELKTLGHQFEDMLIKCQYNGGKCGHSDFTVFQDNKLGNCFTFNSPSPVNVAGT
QNGLKLTLSLEQDEYLGLFTSGEVGVKVLIHDPDVKPSPETDWFYARSGVSTSKEIKRVE
IKRLSEPFGRCSAEYSSVNECREKCLRYEMLEYCGCTDSLIANETAPCDVTDIRQDLCLQ
LLRHIHRTGVVTCDCPLPCSETKYKVEMTSEATWPSSPYVPHLLEELRYSNVTSQVLNDE
TAIRRNLLLLETYYGSMDSENVASFPEYTMQKLMKDIGVSIAIYLSLFMIIALLVYVCCG
PKCDTQKKKDVEITSKKNSIDATTNF
Download sequence
Identical sequences XP_002737666.1.86028 Sakowv30037800m Sakowv30037801m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]