SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30039315m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30039315m
Domain Number 1 Region: 164-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000636
Family EGF-type module 0.024
Further Details:      
 
Domain Number 2 Region: 85-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.029
Further Details:      
 
Domain Number 3 Region: 123-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30039315m
Sequence length 360
Sequence
MESLITNGASIFTKVTVMYLAGTQWYWLIAMVTQLTVTAHAAIVCEGWCYPEGVCVSTDT
QCGCNNSMVVYSTCAHRLQPDLEADCTGKCHNDGTCILHNGLSMCVCPNSYYGNTCQFVR
TETCSKHCLNGGTCQTTKTNNITKETCVCSPRHYGDLCHHVSTGSCSTQLCLNGGTCIDE
FIVPSYCLCKKGYYGNRCEEPEVTYFDESARHPQRLSAGNIAAIVVIVFTTIGLSVGVRY
FRKWKIQRLRRNRQSHNTVLNNRQYIGSSSHSGVNFVQVPDVSPLHSPSPVLQLSPIPSS
YSYASTTGLLTVNPPQSDMGVLVTNGEMPPPYTPIVDHNMTSKSNMTGLQQLNCSSLEET
Download sequence
Identical sequences Sakowv30039315m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]