SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30040339m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30040339m
Domain Number 1 Region: 168-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-68
Family Nuclear receptor ligand-binding domain 0.00000836
Further Details:      
 
Domain Number 2 Region: 99-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-31
Family Nuclear receptor 0.0000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30040339m
Sequence length 435
Sequence
MAMAVSTWRDPNEDLSADKQQHQQQPPPPHQQQQPPPPTQPQPQQQPPQQTPTTPQQTPP
APHQTITPQQTSTPQQPPQQTATPQQTTTPQQTASQQQHIECVVCGDKSSGKHYGQFTCE
GCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRIPPT
QPVPGQYALTDGRFDGHSYLSGFISLLLRAEPYPTSRYGAQCMQSNMMGIDGICELAARL
LFSAVEWARNIPFFPDLQVTDQVALLRMVWSELFVLNASQCSMPLHVAPLLAASGLHTSP
MSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIENLQE
KSQCALEEYVRSQYPNQPNRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRDM
LLSGSSFNWPYMAIQ
Download sequence
Identical sequences B5B3S7
Sakowv30040339m Sakowv30040340m NP_001158369.1.86028 XP_006811654.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]