SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30040585m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30040585m
Domain Number 1 Region: 3680-3726
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000011
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 2 Region: 2120-2254,2296-2329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000172
Family ABC transporter ATPase domain-like 0.073
Further Details:      
 
Domain Number 3 Region: 2461-2628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000456
Family Extended AAA-ATPase domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30040585m
Sequence length 4034
Sequence
MDGKKPLPALGGVADDGLQMGSSSVSIPESIASKTSRPQTATSMLQQKFPSTPETMEVLF
HVLTSPEFNYNDSRDKVIICCNVSQLGGYNNACVVMRQQKKRPFGKHDLFKGHLHVKPRY
IDRWNFEYYYCVVKNYDNEDKMERLPEFVCGKRKLNVPEDKCQVQRTWNQYDDVIYPEKK
SMLGKFLKTLGSGKVLENKMKATLAMLPKWEGFVDGNSVKGSAENAIEHVRQLSLNVSNN
WAPEGFDLKEAILRHFIPRIRSFQTNTFKGTPVLRLVSASTILYVVYHEKLDIHPDMLDV
LFAQLIMQPEQLHGDTWHIDAYETLIHNHFKSQVLKSNLTLALIRLFKKRSMSSTLGDGH
LMWLCGVTLLHFLRNDSQPFTKATQHHHPRHDKVKWYGIEGLEIDNALKCATARQKYEVV
HRLHDVIRADHLLPRTLAYLVTSIVELSQLAKKFPRYVTMVTLYRLLKSHTNPENELKVV
LKILNAAAEQEMSSFNVKHDPNVNDVSICLECTNLTLDILVEIPVMNTDIGVVTACFQMF
ASTYAMYHNACSLQNMDFQKTQQSLNLVQSTMCQWLVKVLTVTRIGNDVSGENVAIFFNR
EFELDDKQKINLFCHTEQHRLHKCVQDVIRQTAFGVVDKCCKGGGIEDMVQTVIRTYKNK
SQADKNVYGILLSHILMSSWPRMGSHENQFTRNSKLLKHIFQWKPMVDILQLTGEKEWDN
KHLIEEGRQLLDITRTLVKDTLAALVDGEMKISDFLSLKENEAEFETLCSLICHKTDNLQ
TLFKCRQQEHSAWKAESQLVHIFYDKTQAILKQDEGTEIKEKLKLSQNEVKFKNICNPNE
YSNASVDSYSPAITMYPFTEEQKTMLTTMETYQHSRIMIYFWNETLLNVRQKVVTSKPRL
SIKELETTIWTPTLQKIFDLKRDVEKGTITLADIDKVFNQFDRNVENIQTELSMIADGNL
GQWVELRTRQIRIYYNVSSVYMAAGIVLNLKETYDLTGDFKSVELLSTKGKDFKNQLLKS
ITEDLDRTGKMLSGFTKERCKSLQVYIEQKKLIDWVKKEMKGINDMKAFLDLSMRVVGEG
DMEVDTIGVLDQAVSGYAPLIFDLSSSDGSTKFLKQCNKLWETLTRDPRLPKKLKETGES
LDYLIKLQKSHGEDEETSLNQACNINRRGVYHVGHLECDDYKLDLKSSIRLTVLQQRGKR
KQKQDEADAINREYSLDDLKDIQSRLMLISHREEEHSEIVERYITLMDLVIRMAETYLKL
RSAGCVSFIDWKVIQHCQPAKRVTTNVFFGASDPMITGSEDAADSMYKLCDFLERCHHQW
LEYINRKRRGYYELNHFTMTQIFQLRRDLAKLRNNEDIHPSTCVLLEGVRTNCGITNLRE
ALRESNNIQNTPARSSTYQPPSCPSGLYMSADMKNTSIKHLIAEGMTDKIAKAAFMACGF
DSDINLLDWCYAYLNNDDIIDAFYVQYIEQYEDSPMDKTPRLFPLEEVDDTAGTSMIQTP
QVESGKQISSVTDQLEALWTHKLESEDAITQGDYITVEHLGKTLECLANDERSLLNRPLK
RFIVPGQPNLVICSHENILSFVLSIYMEDTSLPLPTVEEVLLCTEHTTAEAVSLFWHRAF
LDTRGGIFCLAFADQLSYEVCSASEHILNKLQSSLDKKDYRVLVICSKERENQSYMVSAL
DHFKTDTRFVPDMVAITAYLMDKFQEECSITTHDGFSTGMVTDMRSSVLTIQSNRSGTGK
SLFVERLSTELEARTNHHRESPYCITLPLARKNIDLSSVVHSFSRCIEIDNETHSIFHLD
ISPLVQNGIDNLLFNLLVLRSIQDNSGRVWRRHPVHLYIIELTSQNKARVTPRFQDLLPV
ISCQSPRESLATLDKADGGKRVLHMDNEIYRSDNLQMSYQYLAAFQKEQNLDKLQYSGQA
TESPTQCLLTLLQYCGVADPSWAELNNFTSFLGEQLKDCEDSVFCDPYNLGDTELEGFKT
FVVKFMIAMSKDFATPSVKTSNQSVDANGDNDNGLERFQLRRTWENSPHPYIFFNRDHIT
MTFLGFTIDEMGNLLESGTGNILEPNVMSAQLQRGLTEQHVDLTVDIMHVSRDDMLNKLY
LVFGTQETYDPDPTYELTIDNVKKMMAIHMRFRCGIPVIIMGETGCGKTRLIRFMCDMQA
GTQYDGRAENMIIMKVHGGTTELDIVQTVAHASVQARLNKEQHHIPDTVLFFDEANTTEA
VGLIKEILCDKRVNGTKIDTSNGALKFVAACNPYRRHTKEMIESLEASGLGYYVRADQTE
DTLGSIPMRHLVYRVQPLPPSMLPLVWDFGQLNVDVEKQYILQIVQRFNECSFVSLRDVE
RTMNVMVWFLEKLEYLNPLIEDIKMKSDHPSYEMHYTIPYTVIINSQTPSMLTRALTLSL
GVCYHARLQDQRRAYRIEVAQYFVAPCALPGGEQQMVLEMIRCQDVFLNHIELGPNIARN
TALRENVFMMIVCLELRIPLFLVGKPGSSKSLAKTIVADAMQGISSKNEFFKKLKQVRMV
SYQCSPLSTPEGIISVFRRCGKLQKQQELDNFVSVVVLDELGLAEDSPAMPLKTLHPLLE
YGAEEDNTSQAHMRVGFIGISNWALDPAKMNRGILVSRPDLDEEELKESAIGICHSDNGV
LCRIQGLLSSLAAAYLKVCEKQTRQFFGLRDFYSWGQLEHAVRRNFGGLDEIDIVEIFKD
TLKSTYVTEEHDKNDPDCSTAGLIKASLEVDKSIYIGESRYLLLLTENYAALGILQQILN
WNDHVIIFGSSFPKDQEYTQICRNIHRIKTCMETGRNVVLLNLENLYESLYDALNQYYVY
FGDNRYIDIGLGVLRRKCRVHKDFKLVVIAERQVVYEKFPIPLINRLEKHFLAMASILTA
QQHAVVARLEQWADEFANFSLAGPGGRRIKFSIPDAFIGYNQDTPASIVLRLSSDTKKEK
KDEKVWTSQVLEEAKRVLLQCATPDAVARLNKSKLGPLSNQIWNQYFHEQHHDSIVSYLK
LLMGSGQFKEDTLTQITTHSRLLSRHDTDQMSTELGSDSITVVSLHEFQTEQQFSRKARD
FFNTVTAKIKILVIQCSSGNEHTNLIACSRYLIQDERVKAEKRKLKAGAGGLMTAHVVFI
IQLPRIVGGCFAGFQGGKWNSIHIDELRPAEARLPEITDFENHSISKMFQIGMESKHKSL
TRESDHSGGHERAQERKFVLDTYYVINSCLQTALSMLVDSEDNAHRASERVDLLLKLCKQ
KGKSLYWNVLQERIYDLLRQKDERGVDIKAWLCNEATSGQSMQENGTFRRALLHKLLRTI
THILAEVIAFTDVNDNLSIIENNGEPAWVKTMWFTILGNTGIAPLEYTSFLSPLDVPREH
IPVRSTGIGGSKFRCRCPFSWIIKERLDEMWNSEMHKHEVYYEVVRNSDLGTYLQEIIPE
AMVSDFSNLYLHDFVRMVYRASQLGEYEVLKTNHIFEVILIMDEIEVVAKQIHRDMNAYD
ETHVDFILTPPAIHMAWYKMRLRFESFAQTLVIIPQALQQLNVLERFEEMTIDVYTLTYL
LEVLQPDEHDIRDTTARSQWLRKVKESRPLIDKILAMAESYNEKDEITNIYGGKSKRDLG
IARTMWNRITVLQLFVEHVCVPSLGFKELNIEHTILLKRMLNSDDKVDFKTLDTLAILET
FLNRCVDDVSAKLLKYGIRVCAVCKEAIKDPVLFPCHHIFCLQCVEILLSNGGGACATCR
QKLPLYFQPEVSQDIVDAIEKLSEHRRQFNGFFMEIVSRLCFMGNLPPHSDVIERMLTYV
SKNTRENENIRSKRMSALVEDCIDPTPVLRSFLLQLILKFRKDHVYDHLSDFLQVNLQFC
VDEQDVIELCLLFTQCLEDSYYQEDHHNRTGIIEIALAKLKSGIRPKSVRPSALNISRLE
KIAAARFSLTLTAELIYHYFGGSQDQNESKQRREHIQFTEAMKLIDMAKTYCDRIGNKWP
RLYLLKQLCRRYGRDVTRSVSGIDRFKWIAPDLLVKHDDVPDRFLVYGDNYESIIDALEL
SLHQEDLDRDKDVI
Download sequence
Identical sequences Sakowv30040585m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]