SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30044485m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30044485m
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 4.71e-64
Family Tubulin, GTPase domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 320-498
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 5.19e-58
Family Tubulin, C-terminal domain 0.0000436
Further Details:      
 
Weak hits

Sequence:  Sakowv30044485m
Domain Number - Region: 235-253,288-315
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 0.087
Family Tubulin, GTPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30044485m
Sequence length 515
Sequence
MTQSIVVQVGQCGNQIGCRFWDLALREHASRNKHGVFDEPLSSFFRNVDTRYDDPANIPI
GIGKNKIKTLKARAVLIDMEEGVVNDLLKGPLGDVFDCRQLITDVSGSGNNWAVGHMMYG
QQYREEITESIRRAAEQCDCLQCFFVLHSMGGGTGSGVGTSVLSLLSDEFPDVYRFVTAV
YPSAEDDVITSPYNSVLAMHQLTQHADCVLPVENQVNYTKSVLIPLQLYLPTCSSNSSIC
SDLQALYDICHKISQALPPEKTGKRMVGGHSRVKADSAVTASAGGLVKKSDEKPFDKMNN
IVANLLLNMTSSARFEGSLNVDLNEITMNLVPFPQLHYLVSSLTPLYALSDINLPPRRLD
QMFSDAFSKDHQLIKADPKHSLYLACALMLRGNVEISDVRRNIERLKSSLKFIHWNQEGW
KTGLCSVPPVGQPYSLLTLANNTCIRHTFSDLKDRFVKLYKRKAHVHHYTHVDGMEMSQF
SESLESLTTLMKEYEGLETNMGRIVDDVHRLQIAS
Download sequence
Identical sequences Sakowv30044485m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]