SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045215m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045215m
Domain Number 1 Region: 1905-2004
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 2013-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000206
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1806-1842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1579-1618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000947
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1538-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000108
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1297-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1620-1660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1337-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1378-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000298
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1458-1495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000406
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 1255-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 13 Region: 1174-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000676
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 1497-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000754
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1759-1804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000757
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1660-1699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000222
Family EGF-type module 0.023
Further Details:      
 
Domain Number 18 Region: 665-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000359
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 1417-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000427
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 878-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000119
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 21 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000541
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 23 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000092
Family EGF-type module 0.022
Further Details:      
 
Domain Number 24 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000978
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  Sakowv30045215m
Domain Number - Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 415-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000171
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.0068
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 1707-1756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00046
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000514
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000629
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000812
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 328-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00271
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 962-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00278
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0699
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045215m
Sequence length 2122
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVTTNACDNTPCLNGGTCINLGSGLYSCQCASGWTGNQCQTFVTTNP
CNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPCDNFPCQNGGTCYNLGSGSYS
CQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPC
DNFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGGGSY
SCQCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSYSCQCASGWTGNQCQTFVTT
NPCDNFPCQNGGTCTNLGSGSYSCQCASGWTGNQCQTFVSSTNMCLQNLCLNGATCVNNG
NSQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNCYNTYHSTYLTSPVSLYVCV
CHSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDNDGPGITSKVCMCTVGWVGNT
CEIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQTPDTGTTPCSSDPCPSNQM
CYYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISVNHTVNIFSPQFPRNYPDNE
FCWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAETDVHASGLIRPTSFTSSGK
KIWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQNGGTCLLHRGRSICICAHG
YLGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAICCVLFVFSVLLAATVCRTM
HKKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045215m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]