SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045216m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045216m
Domain Number 1 Region: 1864-1963
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1972-2014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000002
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1765-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1417-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 1579-1618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000952
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1538-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1214-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.018
Further Details:      
 
Domain Number 8 Region: 1297-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1458-1495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.019
Further Details:      
 
Domain Number 10 Region: 1337-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000379
Family EGF-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1256-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000475
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 12 Region: 1174-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000541
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1718-1763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000757
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1376-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1497-1536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000935
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 1619-1658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000298
Family EGF-type module 0.023
Further Details:      
 
Domain Number 18 Region: 665-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000479
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 883-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 22 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000978
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Sakowv30045216m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.0077
Further Details:      
 
Domain Number - Region: 410-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000189
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 538-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000236
Family EGF-type module 0.007
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 1666-1715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000406
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000531
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000622
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 962-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00127
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00271
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 328-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0699
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045216m
Sequence length 2081
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPCD
NFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYS
CQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPC
DNFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGGGSY
SCQCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSYSCQCASGWTGNQCQTFVSS
TNMCLQNLCLNGATCVNNGNSQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNC
YNTYHSTYLTSPVSLYVCVCHSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDND
GPGITSKVCMCTVGWVGNTCEIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQ
TPDTGTTPCSSDPCPSNQMCYYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISV
NHTVNIFSPQFPRNYPDNEFCWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAE
TDVHASGLIRPTSFTSSGKKIWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQ
NGGTCLLHRGRSICICAHGYLGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAI
CCVLFVFSVLLAATVCRTMHKKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045216m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]