SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045217m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045217m
Domain Number 1 Region: 1864-1963
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1972-2014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000002
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1765-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1538-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000703
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000812
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1497-1536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1378-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1297-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1337-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000252
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1579-1619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000342
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1255-1295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 12 Region: 1456-1496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000598
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1174-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000073
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 1718-1763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000757
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1417-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1621-1657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 17 Region: 664-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000299
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000352
Family EGF-type module 0.023
Further Details:      
 
Domain Number 19 Region: 883-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 22 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000978
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Sakowv30045217m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 410-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000189
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.0068
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1666-1715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000406
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000531
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000629
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000676
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000893
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00092
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00127
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 962-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00154
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045217m
Sequence length 2081
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVTTNACDNTPCLNGGTCINLGSGLYSCQCASGWTGNQCQTFVTTNP
CNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPCDNFPCQNGGTCYNLGSGSYS
CQCASGWTGNQCQTSTNPCDNFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPC
NNSPCQNGGTCYNLGGGSYSCQCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSY
SCQCASGWTGNQCQTFVTTNPCDNFPCQNGGTCTNLGSGSYSCQCASGWTGNQCQTFVSS
TNMCLQNLCLNGATCVNNGNSQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNC
YNTYHSTYLTSPVSLYVCVCHSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDND
GPGITSKVCMCTVGWVGNTCEIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQ
TPDTGTTPCSSDPCPSNQMCYYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISV
NHTVNIFSPQFPRNYPDNEFCWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAE
TDVHASGLIRPTSFTSSGKKIWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQ
NGGTCLLHRGRSICICAHGYLGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAI
CCVLFVFSVLLAATVCRTMHKKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045217m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]