SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045230m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045230m
Domain Number 1 Region: 1784-1883
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1892-1934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1685-1721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000106
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1417-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000947
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000954
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1458-1497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1337-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1499-1538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1297-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1174-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1255-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000516
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 12 Region: 1638-1683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1541-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 14 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000325
Family EGF-type module 0.023
Further Details:      
 
Domain Number 15 Region: 666-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1376-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 878-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000978
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 18 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000449
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 20 Region: 410-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000867
Family EGF-type module 0.015
Further Details:      
 
Domain Number 21 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000922
Family EGF-type module 0.016
Further Details:      
 
Domain Number 22 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000947
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Sakowv30045230m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000183
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000219
Family EGF-type module 0.0068
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000257
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 1586-1635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000406
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000594
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000622
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000785
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 368-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00122
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00154
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 962-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 328-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0664
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045230m
Sequence length 2001
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPCD
NFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGGGSYS
CQCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSYSCQCASGWTGNQCQTFVTTN
PCDNFPCQNGGTCTNLGSGSYSCQCASGWTGNQCQTFVSSTNMCLQNLCLNGATCVNNGN
SQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNCYNTYHSTYLTSPVSLYVCVC
HSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDNDGPGITSKVCMCTVGWVGNTC
EIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQTPDTGTTPCSSDPCPSNQMC
YYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISVNHTVNIFSPQFPRNYPDNEF
CWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAETDVHASGLIRPTSFTSSGKK
IWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQNGGTCLLHRGRSICICAHGY
LGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAICCVLFVFSVLLAATVCRTMH
KKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045230m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]