SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045234m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045234m
Domain Number 1 Region: 1743-1842
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1851-1893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1644-1680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000785
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1417-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1297-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1337-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1378-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000252
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1458-1497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000481
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1255-1293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000531
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 451-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000595
Family EGF-type module 0.023
Further Details:      
 
Domain Number 12 Region: 1174-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1597-1642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000703
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1498-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 664-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000299
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 878-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 17 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000487
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 19 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000894
Family EGF-type module 0.016
Further Details:      
 
Domain Number 20 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000092
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Sakowv30045234m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.0077
Further Details:      
 
Domain Number - Region: 415-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00016
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.0068
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000252
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 1545-1594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000406
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000676
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 328-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 962-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00228
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0026
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00369
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0594
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045234m
Sequence length 1960
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVTTNACDNTPCLNGGTCINLGSGLYSCQCASGWTGNQCQTFVTTNP
CNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTSTNPCDNFPCQNGGTCYNLGSGSYS
CQCASGWTGNQCQTFVTTNPCNNSPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVSST
NMCLQNLCLNGATCVNNGNSQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNCY
NTYHSTYLTSPVSLYVCVCHSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDNDG
PGITSKVCMCTVGWVGNTCEIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQT
PDTGTTPCSSDPCPSNQMCYYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISVN
HTVNIFSPQFPRNYPDNEFCWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAET
DVHASGLIRPTSFTSSGKKIWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQN
GGTCLLHRGRSICICAHGYLGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAIC
CVLFVFSVLLAATVCRTMHKKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045234m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]