SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045235m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045235m
Domain Number 1 Region: 1743-1842
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1851-1893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1644-1680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1280-1413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000926
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 1417-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1458-1497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1174-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000568
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1597-1642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000703
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 451-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.023
Further Details:      
 
Domain Number 11 Region: 1498-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 664-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000329
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 878-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000108
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 14 Region: 1255-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000324
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 15 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000487
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 17 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000894
Family EGF-type module 0.016
Further Details:      
 
Domain Number 18 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000092
Family EGF-type module 0.025
Further Details:      
 
Domain Number 19 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  Sakowv30045235m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 415-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 539-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.0068
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000252
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1545-1594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00073
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 328-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00116
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 962-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00298
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0594
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045235m
Sequence length 1960
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTSTNPCDNFPCQNGGTCYNLGSGSYSCQCASGWTGNQCQTFVTTNPCN
NSPCQNGGTCYNLGGGSYSCQCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSYS
CQCASGWTGNQCQTFVTTNPCDNFPCQNGGTCTNLGSGSYSCQCASGWTGNQCQTFVSST
NMCLQNLCLNGATCVNNGNSQYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNCY
NTYHSTYLTSPVSLYVCVCHSNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDNDG
PGITSKVCMCTVGWVGNTCEIIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQT
PDTGTTPCSSDPCPSNQMCYYAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISVN
HTVNIFSPQFPRNYPDNEFCWWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAET
DVHASGLIRPTSFTSSGKKIWITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQN
GGTCLLHRGRSICICAHGYLGDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAIC
CVLFVFSVLLAATVCRTMHKKKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045235m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]