SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30045237m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30045237m
Domain Number 1 Region: 1663-1762
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1771-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 1564-1600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000974
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 1215-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000757
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1337-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1297-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000249
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1378-1418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000029
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1255-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000406
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 1174-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000433
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1517-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000676
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1420-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 12 Region: 664-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000029
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 451-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000298
Family EGF-type module 0.023
Further Details:      
 
Domain Number 14 Region: 878-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 15 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 841-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 17 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000785
Family EGF-type module 0.022
Further Details:      
 
Domain Number 18 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.016
Further Details:      
 
Domain Number 19 Region: 501-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Sakowv30045237m
Domain Number - Region: 751-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1088-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 415-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 538-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.007
Further Details:      
 
Domain Number - Region: 1131-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000241
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 1052-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00026
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 1465-1514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000298
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000475
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000489
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000541
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000649
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 205-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 328-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 626-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 962-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00271
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 579-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30045237m
Sequence length 1880
Sequence
MHVTTINVRMVVLVLLSQDPASYISVLVLLAILDSIVQTLQNPCANSYCQNGGTCVAVLG
SCTDFTCTCPSCYTDQYCTTFIDACQNNQCQNGGVCTAVQGSCTDYTCQCSSCYIGQYCS
TLLNPCSNHLCQNGGVCVPLPGSCTDYQCQCATCYSGQYCTEFSNPCQPNQCQNGGVCTA
SPGSCVSFTCDCPGCYTGFNCETLLDPCQTAFCQNNGICIAQPGSCTDYSCSCVGCYTGQ
YCTTLINPCSVDACQNGGACVPVPGSCTDYTCQCPTCYSGTYCEQFTDACQNNPCQNGGF
CQAVSGTCSQYSCQCTGCYTGPTCSTLLDPCANSFCQNGGQCVPTQGSCTDWTCVCAACY
TGQYCFERINPCANSACQNGGFCIADQESCTQYTCQCTGCYTGTYCTQLINPCDNNPCQN
GGQCQASPSDCSAYSCVCNRCYTGPTCSVEMNPCQTNPCMNGGVCIVDPSDAACSRYICR
CAGCYTGTVCETRTNTQCDVNPCQNNGVCQPLAGSCQGYSCICVSCYTGPTCSLLVPRQC
ETNPCMNGGMCTPSSNSCSDYTCACVGCFTGQNCNQPIQDPCTQNPCNVGSCSIVQGSCT
AFECTCPECYTGENCQNFVQNQCQANSCSNGGICIATPGSCSSFSCQCTGCYSGQFCEIR
ASTACSSNNPCQNGGTCEPMEDCNAYQCNCPSCYVGPHCEYVANTVCTVTSTYQNPCLNG
GYCIPDFTSCSAYTCHCVGCFTGNNCETYSQNQCLNNPCQNGGTCVPETGHCSAYNCMCT
TCYTGPQCQFFLQGQCTINPCQNGGVCQEAQNSCTDFMCQCSGCWTGQRCETYSNTQCDI
NPCQNGGACVAVQGSCQAYICECLSCFVGPNCQFQIQSQCNPNPCLNGGACVVTPNSCSS
YTCTCSGCFTGSHCEIPTSSACSTNPCQNGGTCTAVAGNCEAYTCTCQSCYHGGQCQFFV
ANQCNPNLCQNGGVCVAIPGSCSLFQCQCSGCYSGQYCESSTQHMCDISNPCMNGGTCMP
DQSHCQSYTCACPSCYSGYNCNYLLQSQCNTQPCQNGGICTPTVGSCTDFTCECDGCYIG
QYCQTLSVSACSPNPCMNGGTCNRIGSSCTEYACSCTSCYQGSNCQIPIANPCANSPCQN
GGQCTQVPGSCTDYTCTCLSSCYSGFNCEIALSNPCDNSPCLNGGVCNVNTDCLSFTCSC
QSGYTGNFCQNIVQENRCAPNPCQNGGTCFDYGTGYYCQCPNCYTGTYCQTALASPCQVN
PCLNNGLCTVLTGCISYSCTCQSGYTGNNCQISITSNPCDNFPCQNGGTCYNLGSGSYSC
QCASGWTGNQCQTFVATNPCDNSPCLNGGTCYNLGGGSYSCQCASGWTGNQCQTFVTTNP
CDNFPCQNGGTCTNLGSGSYSCQCASGWTGNQCQTFVSSTNMCLQNLCLNGATCVNNGNS
QYTCICRPDYVGTNCGSSRESTPSLDACQSSPCHSLSNCYNTYHSTYLTSPVSLYVCVCH
SNYLGVNCDSPITDYPDLNMCSTNPCQSGGTCHNTFDNDGPGITSKVCMCTVGWVGNTCE
IIATNPCSSNPCQNSGTCVAFNTYYTCTCATGYAGTQCQTPDTGTTPCSSDPCPSNQMCY
YAGNQYICIGGRRRRDVSTEGSLVPLHGAGVICNTTISVNHTVNIFSPQFPRNYPDNEFC
WWIIEVDGNSKIRVNFEYFATEEHFDWLDIGHGDVVSAETDVHASGLIRPTSFTSSGKKI
WITFKSDHEKTENGFWIQVTSIPNIETSAFAGCSLNPCQNGGTCLLHRGRSICICAHGYL
GDYCEHEMEHTTQLDTNMTSVVTLPFGEMSVYAWSVTAICCVLFVFSVLLAATVCRTMHK
KKRVLNRKVRLDDDGIFVVH
Download sequence
Identical sequences Sakowv30045237m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]