SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30046349m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30046349m
Domain Number 1 Region: 20-107
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000557
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 
Domain Number 2 Region: 121-194
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000053
Family DEATH domain, DD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30046349m
Sequence length 221
Sequence
MLFEQARLLIIAKRKITPEICHRLLLHHRDALVRTLGPRSTLYYLFQERVFSKEMVDDIR
KKGKGNQEDTMNEVIEQLLQRGVREFEVLVKILRKLDHNLLADIMEERRLSGLIHVTEPT
SRKLGYHWKRIATDYLGLGPMIPLIQDRYPEKLREQALFMLLMWEEQDGIGANPKRLIEI
LESCNMRAAADSADTIIGGGKKKKKKKKGKKGKKKKKAKSA
Download sequence
Identical sequences Sakowv30046349m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]