SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|394026|fgenesh2_kg.9_#_849_#_981_2_CFPN from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Serla_S7_9|394026|fgenesh2_kg.9_#_849_#_981_2_CFPN
Domain Number - Region: 15-43
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0448
Family Ubiquitin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|394026|fgenesh2_kg.9_#_849_#_981_2_CFPN
Sequence length 192
Sequence
METLNCWIYGEDVESIFTVNISSSETVYNLKEAIKNKNSSQFRDVEAKYVDLYSICLSDD
EQLEGTLSRWDHSEERKLNGWYKLSTLFSESKEGVWIIIVRAPSSCTHLSLYAITLLTAN
FMTVSSRGSVKILWWYGEAGCGGSLEMKSNRRASITSNIAFLWVARDVQTSCEQMLESES
DRRLRRKPFVKR
Download sequence
Identical sequences F8P1N7 F8Q2R1
XP_007320306.1.27812 jgi|Serla_S7_9|394026|fgenesh2_kg.9_#_849_#_981_2_CFPN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]