SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|450489|estExt_fgenesh2_pm.C_90039 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|450489|estExt_fgenesh2_pm.C_90039
Domain Number 1 Region: 227-317
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000215
Family Thioltransferase 0.031
Further Details:      
 
Domain Number 2 Region: 425-444,474-520,556-567
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000336
Family UBX domain 0.061
Further Details:      
 
Weak hits

Sequence:  jgi|Serla_S7_9|450489|estExt_fgenesh2_pm.C_90039
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily UBA-like 0.00748
Family UBA domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|450489|estExt_fgenesh2_pm.C_90039
Sequence length 622
Sequence
MDHLNPTQREALSQLQAITAGSDAEVTLSVLESVDWDVQKAAELIFDGPPPQSSNAPVSP
EGTEHTRTIMEELAIDDSQQGIDVDRSWRPNGGTHRVSSPRKGLRHFNKYHSQPNTSIWN
SLLSFFSLPFHVLSNTIRFLFGILRISIPSLHFTGLHNYRSVRTGPSDHRSVTDRWVRSL
EEETGALSVSSRTPSGISASGAEAGPSSIISRTGYASDELFEEGRKVLPDFFLGSYEDVL
NVCQREGRVACIVLVSEEHDDVPEFKRSTLTDPALVKALHDGNFVIWGGDVRDRDAWSAA
QKLQATTYPFVAFIALQPRRNHSHTPTPSQSVASPTLTVLSRHQGRSVPDTAPTSAATLL
NHLSQQLLPRVTPFLERFKASIRERERDRMLREEQDRAFQDSARRDRERIEARIAAEKAE
KERLEREREQAKKEEERAALEREKQAKKDEDRMEWRRWMRRDVVRAEPQSQDQGRGKKGG
LRLAIRLPQNERAIRYFTREDTLTQLYAYVDTMLIPPTCSPSGDPKQPPGVATGSVQVLE
EHVSRQLEGVDAWWGFKLALAYPRQEIRWEAGKKLCDVDGLGDGGQLVVELVHNSRKVSV
PSSTVGNNGNGDDGYDTESDEE
Download sequence
Identical sequences F8P0Q5
jgi|Serla_S7_9|450489|estExt_fgenesh2_pm.C_90039 XP_007319979.1.27812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]