SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000033 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000033
Domain Number 1 Region: 63-182,258-363
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.23e-65
Family FabD-like 0.000088
Further Details:      
 
Domain Number 2 Region: 190-265
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000955
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000033   Gene: ENSSSCG00000000031   Transcript: ENSSSCT00000000033
Sequence length 384
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:3164816:3172818:1 gene:ENSSSCG00000000031 transcript:ENSSSCT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARAAWACGWRAGGHRSTSNFPLPPPGAVDVAELLRDAAAGEEGPRVAAARRLPGQ
CSVLLFPGQGSQVVGMGRGLLRYPRVRELYAAARRVLGYDLLELSLHGPQEDLDRTVHCQ
PAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFCEGLYAVKIRAEA
MQEASEAVPSGMLSVLGQPQSKFTVACREAREHCRTLGIENPVCEVANFLFPDCRVISGH
LEALHYLRKNSYKYHFRRTKMVPVSGAFHTRLMEPALEPLAHVLKDIDLKKPLVSVHSNV
TGNKYMHPKHIRQLLVQQVVSPVKWEQTMHAIYERRKGTDFPKTFEVGPGKQLGTILKSC
NLQAWKSYSHVAVLEADQDEDQNL
Download sequence
Identical sequences A0A286ZXK8
ENSSSCP00000000033 9823.ENSSSCP00000000033 XP_003126026.1.46622 ENSSSCP00000000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]