SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000099 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000099
Domain Number 1 Region: 161-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.62e-34
Family G proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 486-574
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.66e-19
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 391-482
Classification Level Classification E-value
Superfamily Translation proteins 1.46e-16
Family Elongation factors 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000099   Gene: ENSSSCG00000000095   Transcript: ENSSSCT00000000101
Sequence length 669
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:6538859:6562654:-1 gene:ENSSSCG00000000095 transcript:ENSSSCT00000000101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERSRSPMDSPVPASMFAPEPSSPGAAKAAAAAARLHGGFDSDCSEDGEALNGEPELD
LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATV
KSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVL
THGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFNSEGNVVNKPDSHGGSLEWTKI
CEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALN
VPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMC
PIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGL
IKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMV
SPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATV
HFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLT
KREEGGSSGGPAVGAPPPGDEACSLGAPQPAASSSLQPQPKPSSGGRRRGGQRHKVKSQG
ACMTPASGC
Download sequence
Identical sequences ENSSSCP00000000099 9823.ENSSSCP00000000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]