SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000404 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000404
Domain Number 1 Region: 432-538
Classification Level Classification E-value
Superfamily Homeodomain-like 9.86e-37
Family SWIRM domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 149-204,244-279
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000017
Family DNA topoisomerase II binding protein 1, TopBP1 0.076
Further Details:      
 
Domain Number 3 Region: 641-692
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000434
Family Homeodomain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000404
Domain Number - Region: 207-234
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0321
Family Chromo domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000404   Gene: ENSSSCG00000000382   Transcript: ENSSSCT00000000410
Sequence length 1167
Comment pep:known chromosome:Sscrofa10.2:5:23227322:23250767:1 gene:ENSSSCG00000000382 transcript:ENSSSCT00000000410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAAGPEPEKMAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKS
LSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRR
YDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVT
EEKNNASHVVCPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDA
PTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDR
RDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSP
VPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTK
NPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNF
MIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPT
SHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQ
MLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYK
DDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTV
AFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLES
SGIAGTTSDEPERIGPEESGTDEARAEGQATEEKKEPKEPREGVGAVEEEAKEKTSEVPK
KDDEKGKEGDSEKESEKSDGDPIGPVDPEKEKEPKEGQEEVLKEVESEGERKTKVERDIG
EGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMD
REREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPP
TGAAGPPTVHGLAMAPASVAPAPAGSGAPPGSLGPSEQIGPAGSAVGPQQQQPAGAPQPG
AVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAAQSPAIVAAVQGNLLPSASP
LPDPGTPLPPDPTAPSPGTVTPVPPPQ
Download sequence
Identical sequences ENSSSCP00000000404 ENSSSCP00000000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]