SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000522 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000522
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily Lysozyme-like 2.63e-52
Family C-type lysozyme 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000522   Gene: ENSSSCG00000000492   Transcript: ENSSSCT00000000530
Sequence length 146
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:36179190:36185575:-1 gene:ENSSSCG00000000492 transcript:ENSSSCT00000000530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLVLALLLLSVSVQAKVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESDFNTKA
INHNVGSTDYGIFQINSRYWCNDGKTPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPL
GVKAWVAWRAHCQNKDVSQYIRGCKL
Download sequence
Identical sequences P12068
ENSSSCP00000000522 ENSSSCP00000000522 NP_999557.2.46622 9823.ENSSSCP00000000522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]