SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000613 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000613
Domain Number 1 Region: 108-175,248-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0081
Further Details:      
 
Domain Number 2 Region: 12-152
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000272
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000613   Gene: ENSSSCG00000000583   Transcript: ENSSSCT00000000627
Sequence length 487
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:55270409:55298002:-1 gene:ENSSSCG00000000583 transcript:ENSSSCT00000000627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVARSPPTAGKFVVVGGGIAGVTCAEQISWAMTFPSEEIPLITASPVIKAVTNFKQVSK
VLEEFDVEEQPSTMLENRFPNIKVIESGVKQLKSEQRCILTEDGNQHVYKKYVLGIRDTD
SAQEFQKQLTQAKRIMIIGNGGIALELVYEIEGCEVIWVIKDKAIGNTFFDAGAAEFLTS
KLIDEKSEAKIAQKRTRYTTEGRKKEAQTKAHAGNIGSALGPDWHEGLDLKGTKEFSHKI
HIETMCEVKNIYLQEEFRISEKKSLIFPKDHHNQSVTTDKEIWPVYVELTNEKIYGCDFI
VSATGVTPNTEPFLCGNNFDVGDDGGLKVDDHMHTSLPDIYAAGDICTASWQPSPVWQQM
RLWTQARQMGWYAAKCMAAASVGESIDMDFSFELFAHVTKFFNYKVVLLGKYNAQGLGPD
HELLLRCTKGQEYIKAVLQNGRMMGAVLIGETDLEETFENLILNQMNLSAYGEDLLDPNI
DIEDYFD
Download sequence
Identical sequences ENSSSCP00000000613 ENSSSCP00000000613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]