SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000000844

Domain assignment for ENSSSCP00000000844 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSSSCP00000000844
Domain Number 1 Region: 446-505
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 260-319
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 3 Region: 318-376
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 600-657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 661-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 396-447
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 8 Region: 897-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 201-264
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 767-830
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000497
Family TSP-1 type 1 repeat 0.0084
Further Details:      
 
Domain Number 11 Region: 713-772
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000844
Domain Number - Region: 144-203
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00405
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 831-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0196
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000844   Gene: ENSSSCG00000000795   Transcript: ENSSSCT00000000861
Sequence length 1154
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:77324374:77431938:-1 gene:ENSSSCG00000000795 transcript:ENSSSCT00000000861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
FAALSDTQGNFLLNGNFVVSMSKKEINIQGAIFEYSGSNNSIERINSTDRLEEELVLQVL
CVGNLYNPDVRYSFSIPTEEKSDLFTWDPYGPWQDCTKMCQGTCLNDKSKATGVHRGDPS
VHDTSWCGNFVSPLLNSSRVKTSGCRGRWHITGKSECSSLCGQGYKSLDIHCMKYSIHKG
QTVPVDDRYCGDQLKPPTREPCHGDCVLTRWHYSEWSQQCSRSCGGGEKSRESYCMNNFG
HRLADRECQGLPRVTIENCNEFSCPRWATSEWSECLVTCGKGTKQRQVWCQLNEDHLSDG
FCDPSTKPESLRPCELHTCASWQVGPWGSCTATCGQGYQMRAGKCVNELLSAVLDDRLCH
GASRPGDRQDCIVTPCSVIPKVGATSLPAVPMGKIAQWRYGSWTPCSVSCGRGSQARYVS
CRDAHDEIADESYCAHIPRPADISLCFSPCGEWQTGNWSPCSASCGHGKTTRQVLCINYH
QPINENYCDPEVRPLIEQECNLAACPPTYDHFPSSSEQPSHFRGRNFPLTHKPEDNQNQG
FHPSIRGNQWRTGPWGSCSSSCAAGVQRRVVVCQDENGQSASYCDAASRPPELKHCDLGP
CPRWSYGSWGECTQTCGGGIKSRFVICQFPNGQISREQNCDLVNKPPSVVQCHMHACPDD
VSWHRGPWKSCSASCGKGLKYREVLCVDRFHGKLEEKYCSHLRKPRTHKACRSARCPSWK
ANRWKQCSVTCGSGLQQRDVYCRLRGVGRVAEEKCDRSTRPYFQRQCWHQDCIQYQWVAG
GWLDCSTSCKQRETRRQVRCVDARNLQVNESFCDPLTRPLSIKRCGNPPCKYIVVTGDSS
QCAGNCGFSYRQRITYCIGIQSTEKYKVHQLWPVDYRECPVLPSPQVYKCNFRTCLHMAT
WKVGKWSKCSVTCGVGVMERRVECMAENGWSSDLCLKHLKPDAQKKCYVNDCKTFTTCKE
IQVKNSSAKDGDYYLNIKGKIIKIYCAGMHLENPKEYISLVKGEEDNFSEVYGFRLQNPY
ECPFNGSRRQDCECKNDYLAAGHTVFSKIRIDLISMQIKTTDFLFAQTVFGNAIPFATAG
DCYSAARCPQGQFSINLAGTGMKIASTAKWLAQGSYASVIIHRSQDGTKVFGRCGGFCGK
CIPHMTTGLPIQVI
Download sequence
Identical sequences ENSSSCP00000000844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.