SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000921 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000921
Domain Number 1 Region: 189-213
Classification Level Classification E-value
Superfamily Notch domain 0.000051
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000921
Domain Number - Region: 682-754
Classification Level Classification E-value
Superfamily EF-hand 0.00307
Family Parvalbumin 0.091
Further Details:      
 
Domain Number - Region: 252-279
Classification Level Classification E-value
Superfamily Notch domain 0.00745
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000921   Gene: ENSSSCG00000000862   Transcript: ENSSSCT00000000941
Sequence length 964
Comment pep:known chromosome:Sscrofa10.2:5:86388466:86413187:1 gene:ENSSSCG00000000862 transcript:ENSSSCT00000000941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQLYSEASVALLKLNNPKDFQELNKQTKKNMTVDGKELTISPAYLLWDLSAISQSKQDE
DVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRN
LSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVP
NCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGSRYIPGGGGTGSMGGGQPWHFG
GGITGVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHFHELYKVTLLPNQTHYV
IPKGECLPYFSFAEIAKRGIEGAYSDNPIIRHASIANKWKTIHLILHSGMNATTIHFNLT
LQSTNGEEFKIQLAVEVDTREEPKRNSTTQKSYQDLVSPTVLLPEVEIPFEDIPEEKRFP
KVKRHDANTTGKFQVEVEVPLVNISLLPKEAQLSLSNLDLQLELGDITLKGYNLSKSALL
RPFLMNPRYAELAVNQAPVTGQRNDSMEAPLGKQVHRSIYPSSLGTPERSQGSLPLPAVT
KKFSSLIVSLEKKETQEKIITGKEQEKNRLGENANSHLGGDEVLPGRKLQYYTDSYLGFL
PWEKKKYFQDLLDEEESLKTQLAYFTDSKHTGRHLKDTFADSLRYVNKILNSKFGFTSRK
VPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNVSQ
VFDEVDTDQSGVLSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANITQLNNIP
PTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSH
VVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRF
LHMHELQEWRAYRDRLKFWTHCVLATLIMFTIVSFFAEQLIALKRKIFPRRRIHKEASPD
RIRV
Download sequence
Identical sequences ENSSSCP00000000921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]