SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000938 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000938
Domain Number 1 Region: 259-481
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-63
Family Nuclear receptor ligand-binding domain 0.00000000372
Further Details:      
 
Domain Number 2 Region: 135-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000938   Gene: ENSSSCG00000000875   Transcript: ENSSSCT00000000958
Sequence length 482
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:87784470:87828141:1 gene:ENSSSCG00000000875 transcript:ENSSSCT00000000958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQELENPIPISPCHSHTSPGFTMEMMSMKPAKGVLTEQAAGPLGQNLEVEPYSQYN
SVPFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGEAGEVEIPVTK
KTRLGASTGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTIGEDGEGRDLR
QVTSTTKSCREKTELTPDQQNSSSLYYGSYSKQRMPQEITNKILKEEFSAEENFLILTEM
ATSHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNRKLPAGHTDLLEE
RIRKSGISDEYITPMFSFYKSIAELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEP
LLEVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEVWD
VQ
Download sequence
Identical sequences ENSSSCP00000000938 9823.ENSSSCP00000000938 ENSSSCP00000000938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]