SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000965 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000965
Domain Number 1 Region: 180-194,379-592
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-59
Family Nuclear receptor ligand-binding domain 0.0000903
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000965   Gene: ENSSSCG00000000902   Transcript: ENSSSCT00000000986
Sequence length 605
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:92480102:92527294:1 gene:ENSSSCG00000000902 transcript:ENSSSCT00000000986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHSTQGKPFLLTNPDGSTPSKVILA
RPDSTPGKVFLTSPDAAGVNQLFFTTPDLSSQHLQLLTDNSASEQGPNKGFDLCVVCGDR
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSG
MFVNIHQSGIKTESAVLMTPDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSTEMSMIE
SLNNGDTSLCEFHQEMQTNGDVSRAFDTLAKALNPGESTACQSSVEGMEGSVHLIAGDSS
INYIEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALG
QENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSTERRKVLMEH
IFKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITK
TYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQI
IGHSI
Download sequence
Identical sequences A0A0B8RTF2 F1SQP7
XP_003126756.1.46622 XP_005664310.1.46622 ENSSSCP00000000965 ENSSSCP00000000965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]