SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000974 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000974
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-23
Family Caspase recruitment domain, CARD 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000974   Gene: ENSSSCG00000000911   Transcript: ENSSSCT00000000995
Sequence length 123
Comment pep:known chromosome:Sscrofa10.2:5:93830785:93831153:1 gene:ENSSSCG00000000911 transcript:ENSSSCT00000000995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEIKAQATGLRKTMLLLDI
LPSRGPKAFDVFLDSLQEFPWVREKLEKAREEAIVELPAGRPQNDPSRPAPKVLELCPLD
VKL
Download sequence
Identical sequences 9823.ENSSSCP00000000974 ENSSSCP00000000974 ENSSSCP00000026780 ENSSSCP00000000974 ENSSSCP00000026780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]