SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000990 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000990
Domain Number 1 Region: 432-641
Classification Level Classification E-value
Superfamily TPR-like 2.04e-32
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000990
Domain Number - Region: 184-253
Classification Level Classification E-value
Superfamily SIS domain 0.0178
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000990   Gene: ENSSSCG00000000927   Transcript: ENSSSCT00000001012
Sequence length 650
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:99022903:99071007:-1 gene:ENSSSCG00000000927 transcript:ENSSSCT00000001012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVEKMAEINLKEVTLIVGLVAACYWNSLFCGFVFDDVSAILDNKDLHPTTPLKTLFQND
FWGTPMSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMMFHAVVSVIFLKVCKLFL
DNRSSMIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIA
LTVFLVAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQT
LIKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLL
NPSELCCDWTMGTIPLIESFLDVRNLATFIFFCFLGALGVFSLRYSGDSSKTVLMALCLM
ALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSILKKLSWVCLSMVIF
THALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHV
QPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQVIPGKKYAARIAPNHLNVYINLA
NLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPSKAKEAYLKALELDRN
NADLWYNLAIVHIELKEPNEALKNFNHALELNPKHKLSLFNSAILMQESG
Download sequence
Identical sequences ENSSSCP00000000990 ENSSSCP00000000990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]